BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_E24 (888 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0686 - 30900748-30902167,30903442-30904742 33 0.40 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 32 0.53 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 32 0.53 03_01_0515 - 3864796-3865425 32 0.53 12_02_0299 - 17051570-17052474,17053542-17053755 31 0.93 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 31 1.2 03_05_0690 + 26778567-26778804,26778950-26779024,26779995-267800... 31 1.2 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 31 1.6 01_01_0482 + 3535083-3535194,3535301-3535467 31 1.6 09_02_0543 + 10427321-10428315,10428440-10429154 30 2.1 07_01_0080 + 587674-588510 30 2.1 12_02_0370 + 18139557-18140469,18140561-18140704,18140804-181409... 30 2.8 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 30 2.8 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 30 2.8 01_06_1731 + 39516897-39517632,39517744-39517912,39517985-395184... 30 2.8 01_06_0317 + 28425408-28426079,28426286-28426351 30 2.8 12_02_1174 - 26696869-26698191 29 3.7 04_01_0610 - 7997406-7998047,7998379-7998426,8000719-8001143,800... 29 4.9 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 29 4.9 01_06_0581 - 30386018-30386440 29 4.9 07_03_1636 + 28290642-28291574 29 6.5 01_01_0975 - 7686297-7686458,7687117-7687245,7687754-7687831,768... 29 6.5 11_06_0610 - 25449085-25453284 28 8.6 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 28 8.6 08_01_0134 + 1067826-1068158 28 8.6 05_06_0026 - 25024807-25025300,25025432-25025495,25025567-250256... 28 8.6 04_04_0293 - 24189344-24189350,24189804-24190026,24190411-241905... 28 8.6 02_05_0868 + 32342967-32343915,32344389-32344447 28 8.6 02_03_0120 + 15463163-15465250 28 8.6 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 28 8.6 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 28 8.6 01_02_0031 + 10364487-10365407 28 8.6 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 32.7 bits (71), Expect = 0.40 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRSRPXPHXP 814 P PPP + P PP P P PP P ++ P P Sbjct: 315 PPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPP 357 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRSRPXPHXP 814 P PPP + P P P P PP P S+P P P Sbjct: 548 PPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPP 590 Score = 29.5 bits (63), Expect = 3.7 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRSRPXP 805 P PPP L VPP P P PP P S P P Sbjct: 604 PPPPPPPILPNRSVPPPPP--PPPPLPNHSVLPPPPPPPP 641 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRSRPXPHXP 814 P PPP PP P P PP P + + P P P Sbjct: 550 PPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPP 592 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 32.3 bits (70), Expect = 0.53 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 667 PXPXXXPSPPARXXXFAPXXATXPXRPPXXXAP 765 P P P PP R FAP A P PP P Sbjct: 64 PMPGSLPPPPPRPPSFAPENALPPSSPPPPSPP 96 >03_01_0515 - 3864796-3865425 Length = 209 Score = 32.3 bits (70), Expect = 0.53 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +2 Query: 689 LPPPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRSRPXPHXP 814 +PPP S PP P + P PP P S P P P Sbjct: 70 MPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSP 111 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRSRPXPHXP 814 PL PP S P P ++P PP P P P P Sbjct: 50 PLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPP 92 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 31.5 bits (68), Expect = 0.93 Identities = 22/88 (25%), Positives = 26/88 (29%), Gaps = 7/88 (7%) Frame = +2 Query: 620 WEPXPXFXXXXPXXXXXXXXXXPLPPPXXXLSXPXVPPXPXVLP-------XPPXPXXSX 778 W P P F P PPP P +PP P P PP P Sbjct: 269 WAPPPAFPFPHLPPIFSPPSPPPPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPPPPP 328 Query: 779 XXXRSRPXPHXPFXXXLWRAAAXPXSLH 862 S P P P + P S++ Sbjct: 329 PPPPSFPWPFPPLAPLFPPYPSPPPSMY 356 Score = 29.9 bits (64), Expect = 2.8 Identities = 19/61 (31%), Positives = 20/61 (32%), Gaps = 6/61 (9%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXP------PXPXXSXXXXRSRPXPHXPFXXXLWRAAAX 847 P PP P PP P + P P P P S P P PF W A Sbjct: 213 PWPPIPFCTPRPWFPPIPFLTPPPPPFLPFPLPPIPFLTPPSPPPPAFPFPLPPWPWAPP 272 Query: 848 P 850 P Sbjct: 273 P 273 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/60 (28%), Positives = 19/60 (31%) Frame = +2 Query: 626 PXPXFXXXXPXXXXXXXXXXPLPPPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRSRPXP 805 P P P PLPP + P PP LP PP P +P P Sbjct: 1139 PPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAP 1198 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRSRPXPHXP 814 P PPP P PP P PP P + P P P Sbjct: 1170 PPPPPLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPPPIPPPP 1212 >03_05_0690 + 26778567-26778804,26778950-26779024,26779995-26780099, 26780869-26781000,26781432-26781571,26782213-26782323, 26782690-26782812,26784166-26784267,26784536-26784546, 26784878-26785103,26785363-26785401,26785413-26785583, 26785674-26785753,26785976-26786039 Length = 538 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 813 GXXGXGRXRXXXXDXXGXGGXGRTXGXGGTXGXEXXXXGGGRG 685 G G GR R G GG G G GG G GG G Sbjct: 2 GKKGKGRHRGRGGGGGGGGGGGGGGGGGGVGGDRGGGGSGGGG 44 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 30.7 bits (66), Expect = 1.6 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Frame = +2 Query: 686 PLPPPXXXLSXPX------VPPXPXVLPXPPXPXXSXXXXRSRPXPHXP 814 P PPP P PP P +LP PP P S + P P P Sbjct: 70 PTPPPPPPAPRPPRRHHRIPPPPPPLLPTPPPPPASISPTPAPPLPPPP 118 >01_01_0482 + 3535083-3535194,3535301-3535467 Length = 92 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 692 PPPXXXLSXPXVPPXPXVLPXPP 760 PPP +S P + P P +LP PP Sbjct: 67 PPPPAPVSSPPIGPAPTLLPPPP 89 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +2 Query: 692 PPPXXXLSXPXVPPXPXVLPXPPXP 766 PPP S P PP P + P PP P Sbjct: 26 PPPAIPESGPPPPPAPDMPPPPPTP 50 >07_01_0080 + 587674-588510 Length = 278 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXP 766 P PPP S P PP P P PP P Sbjct: 94 PPPPPPSSGSPPPPPPPPPPPPPPPPP 120 Score = 29.5 bits (63), Expect = 3.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXP 766 P PPP P PP P P PP P Sbjct: 93 PPPPPPPSSGSPPPPPPPPPPPPPPPP 119 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXP 766 P PPP P PP P P PP P Sbjct: 95 PPPPPSSGSPPPPPPPPPPPPPPPPPP 121 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRS 793 P PPP S PP P P PP P RS Sbjct: 92 PPPPPPPPSSGSPPPPPPPPPPPPPPPPPPLFTRRS 127 >12_02_0370 + 18139557-18140469,18140561-18140704,18140804-18140956, 18141032-18141147,18141231-18141398,18142110-18142334, 18142458-18142577 Length = 612 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/59 (27%), Positives = 19/59 (32%) Frame = +2 Query: 623 EPXPXFXXXXPXXXXXXXXXXPLPPPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRSRP 799 +P P P P P P + P PP P P PP P S + P Sbjct: 52 KPPPPTQTAPPVPVVISEPPPPQPQPEPQPAAPSQPPPPQEQPSPPPPASSNTTQQPPP 110 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 29.9 bits (64), Expect = 2.8 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRSRPXPHXP 814 P+PPP P PP P P PP P + P P P Sbjct: 583 PVPPPE-----PSPPPAPKAAPPPPPPKSTGPGPPRPPPPAMP 620 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRSRPXPHXP 814 P P P + P PP P P PP P + P P P Sbjct: 338 PSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPP 380 >01_06_1731 + 39516897-39517632,39517744-39517912,39517985-39518488, 39518619-39518747,39519849-39519990,39520082-39520453 Length = 683 Score = 29.9 bits (64), Expect = 2.8 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXV-LPXPPXP 766 P PPP P PP P V LP PP P Sbjct: 47 PQPPPPPYQVMPVPPPPPPVGLPVPPLP 74 >01_06_0317 + 28425408-28426079,28426286-28426351 Length = 245 Score = 29.9 bits (64), Expect = 2.8 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXP 766 P P P P PP P LP PP P Sbjct: 106 PQPKPQPRSPEPETPPAPAPLPPPPPP 132 >12_02_1174 - 26696869-26698191 Length = 440 Score = 29.5 bits (63), Expect = 3.7 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +2 Query: 692 PPPXXXLSXPXVPPXPXVLPXPPXP-XXSXXXXRSRPXPHXP 814 PPP P +PP P P PP P S +P P P Sbjct: 141 PPPVKPQPPPSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPP 182 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/43 (32%), Positives = 17/43 (39%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRSRPXPHXP 814 P P P L P PP P +P P P + +P P P Sbjct: 208 PKPQPPPTLPPPSPPPPPPTVP-PRTPGDTPAVVEPKPQPPPP 249 >04_01_0610 - 7997406-7998047,7998379-7998426,8000719-8001143, 8002301-8002589 Length = 467 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRSRPXPHXP 814 P PP + P PP P P P P RP H P Sbjct: 391 PPGPPPLAQAPPRHPPRPWCRPHTPRPRSPHSPTHPRPRLHHP 433 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 29.1 bits (62), Expect = 4.9 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +2 Query: 686 PLPPPXXXLSXPX-VPPXPXV--LPXPPXPXXSXXXXRSRPXP 805 P PPP + P +PP P P PP P + RS P P Sbjct: 281 PPPPPNAPMGMPPRIPPPPVGGTQPPPPPPPLANGPPRSIPPP 323 >01_06_0581 - 30386018-30386440 Length = 140 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 270 SGVRSQVLERLEMRLRSGGGGARRQ 344 SG+ +V +R+E R GGGG RR+ Sbjct: 31 SGIEVKVRKRVEKEARMGGGGRRRR 55 >07_03_1636 + 28290642-28291574 Length = 310 Score = 28.7 bits (61), Expect = 6.5 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 1/60 (1%) Frame = +2 Query: 692 PPPXXXLSXPXVP-PXPXVLPXPPXPXXSXXXXRSRPXPHXPFXXXLWRAAAXPXSLHXA 868 PPP L P P P P L PP P P P P AA P ++ A Sbjct: 171 PPPDAYLRKPSPPSPPPAKLSPPPPPQTQTQPLAKPPAPATPSRAGGHVAALAPPAVAKA 230 >01_01_0975 - 7686297-7686458,7687117-7687245,7687754-7687831, 7688011-7688469,7690648-7690788,7691771-7692421 Length = 539 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = +2 Query: 692 PPPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRSRPXPHXP 814 PPP P +P P L PP P + +P P P Sbjct: 368 PPPSPHAQPPLLPVWPRHLAPPPPPLPAAWAHGHQPAPVDP 408 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRSRPXPHXP 814 PLPPP S PP P P PP P P P P Sbjct: 1135 PLPPPVPVSS----PPPPEKSPPPPAPVILPPPPIKSPPPPAP 1173 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 3/44 (6%) Frame = +2 Query: 692 PPPXXXLSXPX---VPPXPXVLPXPPXPXXSXXXXRSRPXPHXP 814 PPP P +PP P P PP P S P P P Sbjct: 1210 PPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPEKSPPPAAP 1253 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPX-PXVLPXPPXP 766 P PPP P +PP P LP PP P Sbjct: 431 PPPPPPPPPPPPPLPPNMPPPLPPPPEP 458 >08_01_0134 + 1067826-1068158 Length = 110 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 689 LPPPXXXLSXPXVPPXPXVLPXPPXP 766 +PPP P PP P P PP P Sbjct: 1 MPPPLPSSRPPPPPPLPRPHPAPPPP 26 >05_06_0026 - 25024807-25025300,25025432-25025495,25025567-25025662, 25025719-25025929,25026616-25026690,25026820-25027037 Length = 385 Score = 28.3 bits (60), Expect = 8.6 Identities = 16/56 (28%), Positives = 21/56 (37%) Frame = +2 Query: 695 PPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRSRPXPHXPFXXXLWRAAAXPXSLH 862 PP + P PP +P PP P P P P + A A P S++ Sbjct: 10 PPSPVAAAPPPPPVQVPVPPPPPPPLPPAAAAVEPLPPQPVAVVV--AEAEPCSMN 63 >04_04_0293 - 24189344-24189350,24189804-24190026,24190411-24190529, 24191331-24191578 Length = 198 Score = 28.3 bits (60), Expect = 8.6 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -2 Query: 626 APXSSGXAPRHKX-WGPARCSPCAPGPAVRGCLAA 525 AP ++G AP+ GPAR +P A GPA + A Sbjct: 12 APAAAGPAPKATAPAGPARKAPAAAGPAPKATAPA 46 >02_05_0868 + 32342967-32343915,32344389-32344447 Length = 335 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 655 PXXXPXPXXXPSPPARXXXFAPXXATXPXRPP 750 P P P P+PP R P A P PP Sbjct: 113 PGPAPAPSPAPAPPRRRMPSPPPVARRPSTPP 144 >02_03_0120 + 15463163-15465250 Length = 695 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +2 Query: 692 PPPXXXLSXPXVPPXPXVLPXPPXPXXSXXXXRSRPXPH 808 PPP + +PP LP PP P S P PH Sbjct: 284 PPPTKYIGP--MPPNNQPLPPPPSPSPSPPPPSPPPPPH 320 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXP 766 P PPP P PP P P PP P Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPP 379 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXP 766 P PPP P PP P P PP P Sbjct: 121 PPPPPHPPEDPPPHPPHPPDHPPPPPP 147 >01_02_0031 + 10364487-10365407 Length = 306 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 686 PLPPPXXXLSXPXVPPXPXVLPXPPXP 766 P PPP L P PP P +LP P P Sbjct: 170 PPPPPPPALPAPPPPPAP-MLPLAPPP 195 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,689,511 Number of Sequences: 37544 Number of extensions: 251473 Number of successful extensions: 2186 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 1194 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1848 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2495239620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -