BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_E23 (798 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z37983-1|CAA86061.1| 276|Caenorhabditis elegans Hypothetical pr... 82 4e-16 AF039043-7|AAY86190.1| 103|Caenorhabditis elegans Hypothetical ... 29 2.9 U39742-3|AAY86225.1| 188|Caenorhabditis elegans Hypothetical pr... 28 6.7 U55373-1|AAC25894.1| 1829|Caenorhabditis elegans Lethal protein ... 28 8.9 AL033510-7|CAA22069.1| 124|Caenorhabditis elegans Hypothetical ... 28 8.9 AF308445-1|AAG29838.1| 1829|Caenorhabditis elegans LET-418 protein. 28 8.9 >Z37983-1|CAA86061.1| 276|Caenorhabditis elegans Hypothetical protein B0393.1 protein. Length = 276 Score = 82.2 bits (194), Expect = 4e-16 Identities = 35/71 (49%), Positives = 49/71 (69%), Gaps = 5/71 (7%) Frame = -1 Query: 555 IPXIALCNTDSPLRFVDIAIPCNTKSSHSIGLMWWLLAREVLRLRGVLPRDQRW-----D 391 +P I+ NT+SPL+ +DI +PCN K SIGLMWW+LARE+L LRG + R + + Sbjct: 142 VPVISFVNTESPLKLIDIGVPCNNKGERSIGLMWWMLAREILILRGKISRQTGFVLEGKE 201 Query: 390 VVVDLFFYRXP 358 ++ DL+FYR P Sbjct: 202 IMPDLYFYRDP 212 >AF039043-7|AAY86190.1| 103|Caenorhabditis elegans Hypothetical protein F39C12.4 protein. Length = 103 Score = 29.5 bits (63), Expect = 2.9 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 215 CCTRCSSCFWSTPCSRRMVCP 153 CCT CF ST CS VCP Sbjct: 53 CCTN-EECFMSTECSYSAVCP 72 >U39742-3|AAY86225.1| 188|Caenorhabditis elegans Hypothetical protein C25F6.8 protein. Length = 188 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -1 Query: 537 CNTDSPLRFVDIAIPCNTKSSHSIGLMWWLLAREVL 430 CNTD+ R + CNT + +G+ + L+AR ++ Sbjct: 49 CNTDAEFRLIQCCSSCNT---NGVGIAYDLVARSLV 81 >U55373-1|AAC25894.1| 1829|Caenorhabditis elegans Lethal protein 418 protein. Length = 1829 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 2/34 (5%) Frame = +1 Query: 166 LLEQGVLQKQELQRVQQAGRYLQP--MKPLAPVF 261 L+EQ ++ +++L+R A R+LQP + PLA F Sbjct: 1591 LIEQSLVIEEQLRRAAHANRHLQPDNVGPLAQRF 1624 >AL033510-7|CAA22069.1| 124|Caenorhabditis elegans Hypothetical protein Y40H7A.11 protein. Length = 124 Score = 27.9 bits (59), Expect = 8.9 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -1 Query: 486 TKSSHSIGLMWWLLA 442 T+ H IG+MWWL A Sbjct: 72 TRVEHKIGIMWWLCA 86 >AF308445-1|AAG29838.1| 1829|Caenorhabditis elegans LET-418 protein. Length = 1829 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 2/34 (5%) Frame = +1 Query: 166 LLEQGVLQKQELQRVQQAGRYLQP--MKPLAPVF 261 L+EQ ++ +++L+R A R+LQP + PLA F Sbjct: 1591 LIEQSLVIEEQLRRAAHANRHLQPDNVGPLAQRF 1624 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,239,375 Number of Sequences: 27780 Number of extensions: 261470 Number of successful extensions: 727 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 699 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 726 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1945792630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -