BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_E20 (795 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 24 1.9 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 24 1.9 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 23 3.3 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 23 3.3 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 7.5 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 10.0 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 10.0 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 21 10.0 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 23.8 bits (49), Expect = 1.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 387 TTSQRWSRGSTPRSLSTSLANNHHIKP 467 T +Q WSRG+T SL S + + P Sbjct: 18 TQAQHWSRGNTWLSLDNSNMSMSSVGP 44 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 23.8 bits (49), Expect = 1.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 387 TTSQRWSRGSTPRSLSTSLANNHHIKP 467 T +Q WSRG+T SL S + + P Sbjct: 18 TQAQHWSRGNTWLSLDNSNMSMSSVGP 44 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.0 bits (47), Expect = 3.3 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -1 Query: 63 CINTLHWLIILHES 22 C N ++W+I LH S Sbjct: 418 CFNLMYWIIYLHIS 431 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 23.0 bits (47), Expect = 3.3 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -1 Query: 63 CINTLHWLIILHES 22 C N ++W+I LH S Sbjct: 418 CFNLMYWIIYLHIS 431 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 7.5 Identities = 6/30 (20%), Positives = 16/30 (53%) Frame = -3 Query: 610 VLDPAQDHQPITEASYVNIPVIALCNTDSP 521 ++DP ++++ E + IP++ + P Sbjct: 167 IVDPVEENETYDEFDTIRIPIVRSLSKSPP 196 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 10.0 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = -2 Query: 500 YPMQHQVFPLYWFDVVVV 447 +P ++++P Y+FD V+ Sbjct: 159 FPAIYEIYPNYFFDSSVI 176 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.4 bits (43), Expect = 10.0 Identities = 6/18 (33%), Positives = 13/18 (72%) Frame = -2 Query: 500 YPMQHQVFPLYWFDVVVV 447 +P ++++P Y+FD V+ Sbjct: 159 FPAIYEIYPNYFFDSSVI 176 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 21.4 bits (43), Expect = 10.0 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +2 Query: 632 ECSLDLVSKSTWCE 673 E S+DLV ST+CE Sbjct: 260 ERSVDLVVTSTYCE 273 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,885 Number of Sequences: 438 Number of extensions: 4372 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25125039 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -