BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_E18 (824 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0581 - 30386018-30386440 29 4.5 05_03_0122 - 8669422-8669609,8669759-8670111,8670669-8670824,867... 28 7.8 >01_06_0581 - 30386018-30386440 Length = 140 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 270 SGVRSQVLERLEMRLRSGGGGARRQ 344 SG+ +V +R+E R GGGG RR+ Sbjct: 31 SGIEVKVRKRVEKEARMGGGGRRRR 55 >05_03_0122 - 8669422-8669609,8669759-8670111,8670669-8670824, 8670999-8671168,8672133-8672297,8673190-8673384, 8673506-8673634,8673759-8673980 Length = 525 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = -3 Query: 735 NXXEWFEXRRLGIXRXLSSXXQSXDPWXGESSRANVPDVFPGDA 604 N +W E +LG+ L + S +PW SSR + DA Sbjct: 288 NAFKWAEKYKLGVIIDLHAAPGSQNPWEHSSSRDGTQEWGTSDA 331 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,491,093 Number of Sequences: 37544 Number of extensions: 180994 Number of successful extensions: 584 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 568 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 583 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2268190812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -