BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_E17 (796 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28070| Best HMM Match : RRM_1 (HMM E-Value=1.3e-07) 64 2e-10 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 28 7.6 >SB_28070| Best HMM Match : RRM_1 (HMM E-Value=1.3e-07) Length = 694 Score = 63.7 bits (148), Expect = 2e-10 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -2 Query: 588 GMEIDGRRIRVDYSITQRAHTPTPGIYMGK 499 G+E+DGRRIRVDYS+T+RAHTPTPG+YMGK Sbjct: 224 GIELDGRRIRVDYSVTKRAHTPTPGVYMGK 253 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 28.3 bits (60), Expect = 7.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 588 GMEIDGRRIRVDYSITQRAHTPTPGIYMG 502 G EIDG IRVD + +AH +++G Sbjct: 33 GEEIDGFHIRVDLASNDKAHDHQRSVFIG 61 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,269,629 Number of Sequences: 59808 Number of extensions: 328445 Number of successful extensions: 650 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 650 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2191792647 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -