BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_E17 (796 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z92826-4|CAB07322.1| 309|Caenorhabditis elegans Hypothetical pr... 47 2e-05 U28735-6|AAF99954.1| 1493|Caenorhabditis elegans Hypothetical pr... 29 2.9 >Z92826-4|CAB07322.1| 309|Caenorhabditis elegans Hypothetical protein C18D11.4 protein. Length = 309 Score = 46.8 bits (106), Expect = 2e-05 Identities = 17/27 (62%), Positives = 24/27 (88%) Frame = -2 Query: 582 EIDGRRIRVDYSITQRAHTPTPGIYMG 502 ++DG +IRVD+S+T+R H+PTPG YMG Sbjct: 141 DLDGHKIRVDFSLTKRGHSPTPGQYMG 167 >U28735-6|AAF99954.1| 1493|Caenorhabditis elegans Hypothetical protein F48E3.3 protein. Length = 1493 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -3 Query: 692 VQVVIDAKTGRSPRVLLRYXEDMEDAKIAKNECTREW 582 +QVVID+ TG+S RV + E ME+ + ++ W Sbjct: 1149 LQVVIDSFTGKSVRVRVEKREGMEERNLLSDDEEGVW 1185 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,113,839 Number of Sequences: 27780 Number of extensions: 240648 Number of successful extensions: 498 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 498 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1935274832 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -