BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_E13 (790 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC106.10 |pka1|tpk, git6|cAMP-dependent protein kinase catalyt... 26 7.1 SPBC56F2.05c |||transcription factor |Schizosaccharomyces pombe|... 25 9.4 SPAC2C4.14c |ppk11||PAK-related kinase Ppk11|Schizosaccharomyces... 25 9.4 >SPBC106.10 |pka1|tpk, git6|cAMP-dependent protein kinase catalytic subunit Pka1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 512 Score = 25.8 bits (54), Expect = 7.1 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = +3 Query: 63 DAALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKTDSIDLRDPNGLRRRVSR 242 D +PS P +SS+ S RH + +L S + D LRD + + RVS+ Sbjct: 119 DNLIPSPLPESASRSSSQSSHQRHSRDGRGELGSEHGERRSAMDG--LRDRHIRKVRVSQ 176 >SPBC56F2.05c |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 397 Score = 25.4 bits (53), Expect = 9.4 Identities = 32/133 (24%), Positives = 48/133 (36%), Gaps = 1/133 (0%) Frame = -1 Query: 466 SNTAQYERNRSFGHLVHALGRAAGGAKLPSAGLCLNASKAGAGLAESGKDMLTVEPRESG 287 S+T+ R H L ++ L S G +S + GK+ V P + Sbjct: 271 SSTSAKRRRPDHNH-TSTLDASSSNTSLASTGPMTVSSST---VERKGKEASEVNPNSTS 326 Query: 286 GSKQCDFTSRVSHSKRETRRRSPFGSRRSMLSVFFLTRASRLRRSGYNSVRC-RGSE*SV 110 DF + +S S+ ++S G R R R +G NS C + V Sbjct: 327 SVTFSDFAAAISRSRCSRCKKSKKGCDRQ-------RPCGRCRDAGLNSEDCISDDDMPV 379 Query: 109 DDFRSWRGVVLGR 71 + R RG GR Sbjct: 380 SNARKPRGRGRGR 392 >SPAC2C4.14c |ppk11||PAK-related kinase Ppk11|Schizosaccharomyces pombe|chr 1|||Manual Length = 312 Score = 25.4 bits (53), Expect = 9.4 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -1 Query: 112 VDDFRSWRGVVLGRAASCCDLLRLS 38 VD FR W + SC DLL+LS Sbjct: 72 VDGFRLWITMEYCDGGSCLDLLKLS 96 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,909,858 Number of Sequences: 5004 Number of extensions: 55727 Number of successful extensions: 144 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 144 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 383374054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -