BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_E02 (794 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.8 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 2.8 DQ855502-1|ABH88189.1| 126|Tribolium castaneum chemosensory pro... 23 3.7 DQ855495-1|ABH88182.1| 126|Tribolium castaneum chemosensory pro... 23 3.7 S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subu... 21 8.6 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +3 Query: 96 RKKHGEDLPTGGRSRRKGEKLE*MQREEQFCCP*EP 203 ++K +D GG S +K + ++ Q+C P P Sbjct: 557 KRKRKQDPADGGNSMKKCRARYGLDQQNQWCKPCRP 592 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +3 Query: 96 RKKHGEDLPTGGRSRRKGEKLE*MQREEQFCCP*EP 203 ++K +D GG S +K + ++ Q+C P P Sbjct: 449 KRKRKQDPADGGNSMKKCRARYGLDQQNQWCKPCRP 484 >DQ855502-1|ABH88189.1| 126|Tribolium castaneum chemosensory protein 16 protein. Length = 126 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 455 GAKLVIHHSLENK 493 G + VIHH +ENK Sbjct: 82 GVRKVIHHLIENK 94 >DQ855495-1|ABH88182.1| 126|Tribolium castaneum chemosensory protein 9 protein. Length = 126 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 455 GAKLVIHHSLENK 493 G + VIHH +ENK Sbjct: 82 GVRKVIHHLIENK 94 >S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subunit protein. Length = 141 Score = 21.4 bits (43), Expect = 8.6 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 530 PSSLGMXKGVSPPYFQVNDESQASRLIS 447 P+S+G+ VS P F+V Q + IS Sbjct: 21 PNSVGVSNEVSLPQFKVLGHRQRAMEIS 48 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,558 Number of Sequences: 336 Number of extensions: 3196 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21583952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -