BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_D22 (799 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 24 1.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 3.7 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 23 3.7 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 21 8.6 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 296 DAEKSGLXKRNPAMKAEKLRERRRKNI 216 DA SGL P + E++ E+ R+N+ Sbjct: 356 DAVTSGLLPVRPPLTREEIHEKARENL 382 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +1 Query: 514 WGRLKFFFCFDGVFHDPNK 570 WG+ + F C G+ D NK Sbjct: 1299 WGKYEVFNCAPGLHWDNNK 1317 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 22.6 bits (46), Expect = 3.7 Identities = 13/42 (30%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = -1 Query: 592 PHSAGLTPY--SGHGRHHRNKRRTSTCPSQRWPTLTSHVFSS 473 P S G++PY S H HH R P ++SS Sbjct: 40 PLSLGMSPYASSQHHHHHLQARPPQDSPYDASVAAACKLYSS 81 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -3 Query: 755 YPA*GAPHNFXTXIQGLXRAFR 690 YP G NF T + L AFR Sbjct: 144 YPLEGDRANFITLLSDLKEAFR 165 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 127,186 Number of Sequences: 336 Number of extensions: 2243 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21687721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -