BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_D13 (776 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 21 9.7 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 9.7 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 21 9.7 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 21 9.7 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 21 9.7 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = -3 Query: 681 YINPIIKSPIPYTNHPRLNIHFHQSPDAVXEGVR 580 Y +P+ + + Y N + +Q D EGV+ Sbjct: 266 YYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQ 299 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 9.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 527 PSSLGMXKGVSPPYFQVNDESQASRLIS 444 P+S+G+ VS P F+V Q + IS Sbjct: 174 PNSVGVSNEVSLPQFKVLGHRQRAMEIS 201 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = -3 Query: 681 YINPIIKSPIPYTNHPRLNIHFHQSPDAVXEGVR 580 Y +P+ + + Y N + +Q D EGV+ Sbjct: 266 YYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQ 299 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 21.4 bits (43), Expect = 9.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 527 PSSLGMXKGVSPPYFQVNDESQASRLIS 444 P+S+G+ VS P F+V Q + IS Sbjct: 113 PNSVGVSNEVSLPQFKVLGHRQRAMEIS 140 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 9.7 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = -3 Query: 681 YINPIIKSPIPYTNHPRLNIHFHQSPDAVXEGVR 580 Y +P+ + + Y N + +Q D EGV+ Sbjct: 266 YYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQ 299 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,067 Number of Sequences: 438 Number of extensions: 4187 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24396777 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -