BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_D09 (818 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 23 2.6 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 23 2.6 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 7.8 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 23.4 bits (48), Expect = 2.6 Identities = 11/60 (18%), Positives = 25/60 (41%) Frame = -3 Query: 549 FGQNGAEIVFNPSATIAGEGGSEYMWNVEARNAAITNCYFTAAINRVGYEEFPNEFTSAD 370 +G G +I+ + + G ++ ++ + + Y AIN YE+ +F + Sbjct: 187 YGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDDYLDYAINPFDYEKRSTDFQDVE 246 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 23.4 bits (48), Expect = 2.6 Identities = 11/60 (18%), Positives = 25/60 (41%) Frame = -3 Query: 549 FGQNGAEIVFNPSATIAGEGGSEYMWNVEARNAAITNCYFTAAINRVGYEEFPNEFTSAD 370 +G G +I+ + + G ++ ++ + + Y AIN YE+ +F + Sbjct: 187 YGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDDYLDYAINPFDYEKRSTDFQDVE 246 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 7.8 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -3 Query: 378 SADGKPAHKDLGLFYGSSYFCGPDGVRCP 292 +AD KP K F GP+G++ P Sbjct: 1119 TADNKPQLKPQKPFTSPGGIPGPNGIKMP 1147 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,197 Number of Sequences: 438 Number of extensions: 4080 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26096055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -