BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_D08 (805 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81534-4|CAB04345.1| 277|Caenorhabditis elegans Hypothetical pr... 28 6.8 Z93387-2|CAB07650.1| 763|Caenorhabditis elegans Hypothetical pr... 28 9.0 DQ178242-1|ABA18181.1| 578|Caenorhabditis elegans Frizzled homo... 28 9.0 AF016413-2|ABA54421.1| 578|Caenorhabditis elegans Caenorhabditi... 28 9.0 AF016413-1|ABA54422.1| 550|Caenorhabditis elegans Caenorhabditi... 28 9.0 AB026113-1|BAA84678.1| 550|Caenorhabditis elegans Cfz2 protein. 28 9.0 >Z81534-4|CAB04345.1| 277|Caenorhabditis elegans Hypothetical protein F37H8.5 protein. Length = 277 Score = 28.3 bits (60), Expect = 6.8 Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +2 Query: 542 G*TIQRLANFCFAMIGRADIEGSKSNVAMNAWLPQASY-PWWYFSGTS 682 G IQRL C AD++ + N W Q + PW +G S Sbjct: 185 GGDIQRLTQSCLVSKLGADLQNKAAAATANVWPEQHKFVPWVIINGVS 232 >Z93387-2|CAB07650.1| 763|Caenorhabditis elegans Hypothetical protein T02E9.3 protein. Length = 763 Score = 27.9 bits (59), Expect = 9.0 Identities = 21/74 (28%), Positives = 34/74 (45%), Gaps = 2/74 (2%) Frame = -3 Query: 428 FGHLVHALGRAAGGAKLPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSKQCDFTSRV 249 FG L H G LP + S+ + ++++G + R+SGGSK+ + Sbjct: 212 FGQLTHRGGERERRHSLPRVIIEEVRSRRGSRMSQTGSQSGSPTRRQSGGSKERSPSQPD 271 Query: 248 SH--SKRETRRRSP 213 H +K + R RSP Sbjct: 272 IHIVAKPQQRWRSP 285 >DQ178242-1|ABA18181.1| 578|Caenorhabditis elegans Frizzled homolog protein. Length = 578 Score = 27.9 bits (59), Expect = 9.0 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +3 Query: 57 RRRSTEHN-TPPGTEVVYRLFRAPTSN*VISGPSEP*CTC*EKNR*HRSPRSKWASTSRL 233 + ++ HN +P G EV + N VI+GPSE CTC + + S +SK + + Sbjct: 162 QNQNQNHNYSPDGPEVGI----SKIDNEVIAGPSECQCTCNQPFQFVASEKSKVGNVTNC 217 Query: 234 AF 239 A+ Sbjct: 218 AY 219 >AF016413-2|ABA54421.1| 578|Caenorhabditis elegans Caenorhabditis frizzled homologprotein 2, isoform a protein. Length = 578 Score = 27.9 bits (59), Expect = 9.0 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +3 Query: 57 RRRSTEHN-TPPGTEVVYRLFRAPTSN*VISGPSEP*CTC*EKNR*HRSPRSKWASTSRL 233 + ++ HN +P G EV + N VI+GPSE CTC + + S +SK + + Sbjct: 162 QNQNQNHNYSPDGPEVGI----SKIDNEVIAGPSECQCTCNQPFQFVASEKSKVGNVTNC 217 Query: 234 AF 239 A+ Sbjct: 218 AY 219 >AF016413-1|ABA54422.1| 550|Caenorhabditis elegans Caenorhabditis frizzled homologprotein 2, isoform b protein. Length = 550 Score = 27.9 bits (59), Expect = 9.0 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +3 Query: 57 RRRSTEHN-TPPGTEVVYRLFRAPTSN*VISGPSEP*CTC*EKNR*HRSPRSKWASTSRL 233 + ++ HN +P G EV + N VI+GPSE CTC + + S +SK + + Sbjct: 162 QNQNQNHNYSPDGPEVGI----SKIDNEVIAGPSECQCTCNQPFQFVASEKSKVGNVTNC 217 Query: 234 AF 239 A+ Sbjct: 218 AY 219 >AB026113-1|BAA84678.1| 550|Caenorhabditis elegans Cfz2 protein. Length = 550 Score = 27.9 bits (59), Expect = 9.0 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 1/62 (1%) Frame = +3 Query: 57 RRRSTEHN-TPPGTEVVYRLFRAPTSN*VISGPSEP*CTC*EKNR*HRSPRSKWASTSRL 233 + ++ HN +P G EV + N VI+GPSE CTC + + S +SK + + Sbjct: 162 QNQNQNHNYSPDGPEVGI----SKIDNEVIAGPSECQCTCNQPFQFVASEKSKVGNVTNC 217 Query: 234 AF 239 A+ Sbjct: 218 AY 219 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,797,994 Number of Sequences: 27780 Number of extensions: 365225 Number of successful extensions: 1057 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1021 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1057 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1966828226 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -