BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_D06 (783 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 27 0.26 AJ876408-1|CAI45289.1| 52|Apis mellifera putative diuretic hor... 22 5.6 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 22 7.4 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 9.8 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 26.6 bits (56), Expect = 0.26 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 323 LPQPKMANTDLTRLLKSDEIRKVLRAPNKRV 231 LP P N L L+ S E+R+ +APN V Sbjct: 490 LPPPYRLNKPLMSLITSSEVRQPGKAPNYSV 520 >AJ876408-1|CAI45289.1| 52|Apis mellifera putative diuretic hormone-I protein. Length = 52 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = -2 Query: 158 VLKRKAILELRRRKNLK 108 VL+++ +LEL RRK L+ Sbjct: 19 VLRQRVLLELARRKALQ 35 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.8 bits (44), Expect = 7.4 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -2 Query: 425 HLGRFVIWTQSAFGRLDPLFGSWKTPSEQKKNFNLP 318 H + WT ++ P G +KT S+ F+LP Sbjct: 25 HRPAWWFWTATSHEASAPAEGKFKTVSKVPGPFSLP 60 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/26 (26%), Positives = 14/26 (53%) Frame = +3 Query: 243 GSTEDLPDLIRLEKTCEVSVGHLWLG 320 GS +++ ++R K C + W+G Sbjct: 349 GSDQEVAGVMRAVKRCNATGAFSWIG 374 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,666 Number of Sequences: 438 Number of extensions: 3297 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -