BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_C20 (894 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 23 3.8 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 23 3.8 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 8.7 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.0 bits (47), Expect = 3.8 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +3 Query: 699 TSSAYIDLPPYTPTAHLRQWGGVVTTF 779 TS LPP + T + W GV TF Sbjct: 288 TSGINASLPPVSYTKAIDIWTGVCLTF 314 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 23.0 bits (47), Expect = 3.8 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +3 Query: 699 TSSAYIDLPPYTPTAHLRQWGGVVTTF 779 TS LPP + T + W GV TF Sbjct: 288 TSGINASLPPVSYTKAIDIWTGVCLTF 314 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.8 bits (44), Expect = 8.7 Identities = 9/39 (23%), Positives = 16/39 (41%) Frame = +2 Query: 614 SGGWIGPGVFYGGQNSVDGVSRRSDGSLNELCLYRPPTV 730 SG + G N SR + + + ++PPT+ Sbjct: 601 SGSGSAENLSSGSNNQTSSASRENTSNTTSMESFKPPTL 639 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 243,772 Number of Sequences: 438 Number of extensions: 5476 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 28904421 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -