BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_C19 (792 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g38340.1 68417.m05420 RWP-RK domain-containing protein simila... 31 0.66 At5g18620.2 68418.m02206 DNA-dependent ATPase, putative similar ... 29 3.5 At5g18620.1 68418.m02205 DNA-dependent ATPase, putative similar ... 29 3.5 At5g16460.1 68418.m01924 hypothetical protein similar to unknown... 29 3.5 At4g07675.1 68417.m01204 hypothetical protein 29 4.7 At3g06400.1 68416.m00738 DNA-dependent ATPase, putative similar ... 29 4.7 At1g47786.1 68414.m05316 acyl-protein thioesterase-related simil... 28 8.2 >At4g38340.1 68417.m05420 RWP-RK domain-containing protein similar to nodule inception protein GI:6448579 from (Lotus japonicus); contains Pfam profile: PF02042 RWP-RK domain Length = 767 Score = 31.5 bits (68), Expect = 0.66 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = +3 Query: 636 IPPSAXPVSSGTPGYSCDSFCCSSGADLLG 725 +PP + P SSG+ S S CCSS LG Sbjct: 598 VPPKSPPSSSGSQSSSGSSTCCSSEEQQLG 627 >At5g18620.2 68418.m02206 DNA-dependent ATPase, putative similar to DNA-dependent ATPase SNF2H [Mus musculus] GI:14028669; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00249: Myb-like DNA-binding domain Length = 1072 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -2 Query: 614 EVRDKDGEFDDWFESDGQRELRQIFQGQAQIHDVLR 507 EV FD+WF+ G+ + +++ Q Q+H VLR Sbjct: 371 EVFSSAETFDEWFQISGENDQQEVVQ---QLHKVLR 403 >At5g18620.1 68418.m02205 DNA-dependent ATPase, putative similar to DNA-dependent ATPase SNF2H [Mus musculus] GI:14028669; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00249: Myb-like DNA-binding domain Length = 1069 Score = 29.1 bits (62), Expect = 3.5 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -2 Query: 614 EVRDKDGEFDDWFESDGQRELRQIFQGQAQIHDVLR 507 EV FD+WF+ G+ + +++ Q Q+H VLR Sbjct: 371 EVFSSAETFDEWFQISGENDQQEVVQ---QLHKVLR 403 >At5g16460.1 68418.m01924 hypothetical protein similar to unknown protein (pir||T02326) Length = 368 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/60 (28%), Positives = 24/60 (40%), Gaps = 2/60 (3%) Frame = +2 Query: 8 FFFLYRAYMNMSANCMAATSRMAVKLAQVAAGHGGGATCAW--AISLCETPPTVCLMLVI 181 FF LYR+Y AA + AQ+A G G W + C + L L++ Sbjct: 49 FFLLYRSYRRAVVTVSAAEKAVKRAPAQIAGGAGRVVRRTWFGILGACHVSMVMVLALIL 108 >At4g07675.1 68417.m01204 hypothetical protein Length = 167 Score = 28.7 bits (61), Expect = 4.7 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -2 Query: 617 DEVRDKDGEFDDWFESDGQRELRQIFQGQAQIHDVLRDLNKKVDE 483 D D+D FD WFE+D +R F + + D ++ K DE Sbjct: 39 DHHHDEDQTFDQWFETDDFANIRDSFLCLSDLVDA-PEVQKPNDE 82 >At3g06400.1 68416.m00738 DNA-dependent ATPase, putative similar to DNA-dependent ATPase SNF2H [Mus musculus] GI:14028669; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00249: Myb-like DNA-binding domain Length = 1055 Score = 28.7 bits (61), Expect = 4.7 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -2 Query: 590 FDDWFESDGQRELRQIFQGQAQIHDVLR 507 FD+WF+ G+ + +++ Q Q+H VLR Sbjct: 374 FDEWFQISGENDQQEVVQ---QLHKVLR 398 >At1g47786.1 68414.m05316 acyl-protein thioesterase-related similar to hypothetical protein GB:AAD55623 GI:5903064 from [Arabidopsis thaliana] contains similarity to acyl-protein thioesterase-1 [Homo sapiens] gi|9965372|gb|AAG10063 Length = 186 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = -1 Query: 336 GQQSAHDQHHSRAQGLRDXRWLANPTRCWRPAAVL 232 G+ SA+ +R GLR+ +W+ PT RP +L Sbjct: 66 GETSANSVRFARQLGLRNIKWIC-PTAPRRPVTIL 99 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,242,650 Number of Sequences: 28952 Number of extensions: 230628 Number of successful extensions: 745 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 726 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1785055200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -