BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_C18 (798 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0581 - 30386018-30386440 29 4.3 07_01_1103 + 10141766-10143583 29 5.7 01_05_0117 - 18300157-18301106,18301149-18301543,18302592-183026... 28 9.9 >01_06_0581 - 30386018-30386440 Length = 140 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +3 Query: 270 SGVRSQVLERLEMRLRSGGGGARRQ 344 SG+ +V +R+E R GGGG RR+ Sbjct: 31 SGIEVKVRKRVEKEARMGGGGRRRR 55 >07_01_1103 + 10141766-10143583 Length = 605 Score = 28.7 bits (61), Expect = 5.7 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = +2 Query: 548 QKQEHHGEHGAGRXRVCPGRVSGKTSGTLXRXLPPRXGP 664 +++ GE G GR R P +T+ R +PP+ P Sbjct: 170 KREPQSGEDGVGRARAAPQSAGTETALLEERVMPPQPAP 208 >01_05_0117 - 18300157-18301106,18301149-18301543,18302592-18302681, 18303723-18303836,18303903-18304046,18316147-18316312, 18316396-18317130,18317219-18317422,18317496-18318177, 18318272-18318528,18318604-18319298,18319345-18319382, 18319847-18319928,18320018-18320112,18320443-18320526, 18320601-18320891,18321521-18321853,18321948-18322150, 18322243-18322399,18322482-18322585,18322675-18322835, 18323511-18323824,18324317-18324589,18324666-18324967, 18325459-18325549,18326140-18326190,18326700-18326768, 18326926-18327017,18327082-18327148,18328582-18328746, 18329027-18329103,18329572-18329766,18330208-18330275, 18331081-18331172,18331399-18331522,18331608-18331705, 18332384-18332997,18333620-18333626 Length = 2892 Score = 27.9 bits (59), Expect = 9.9 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 237 HHALCSHDHSGSGVRSQVLERLEMRLRSGGGGAR 338 H A C+ D G GVR + + RLR+G G+R Sbjct: 1373 HEAHCAQDRRGDGVRPRQIR----RLRAGEAGSR 1402 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,913,906 Number of Sequences: 37544 Number of extensions: 206199 Number of successful extensions: 669 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 668 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2162420256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -