SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP01_T7_C17
         (803 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF225975-1|AAF74117.1|  256|Tribolium castaneum unknown protein.       25   0.93 
DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.          22   6.6  
AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain tran...    21   8.7  
AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia or...    21   8.7  

>AF225975-1|AAF74117.1|  256|Tribolium castaneum unknown protein.
          Length = 256

 Score = 24.6 bits (51), Expect = 0.93
 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 1/32 (3%)
 Frame = -1

Query: 674 FTTMQTF-YRNKSYQPPRKLQFYGVPPLLHDV 582
           FTT + +  R K Y PPR    YG P   ++V
Sbjct: 125 FTTERNWEIREKPYTPPRLPTVYGKPEQNYEV 156


>DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.
          Length = 822

 Score = 21.8 bits (44), Expect = 6.6
 Identities = 8/21 (38%), Positives = 12/21 (57%)
 Frame = +3

Query: 9   FFFPT*AESLERLCQRNPNFS 71
           FFFP   ++L      NPN++
Sbjct: 651 FFFPRWRQTLAMWLNHNPNYA 671


>AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain
           transcription factor Maxillopediaprotein.
          Length = 523

 Score = 21.4 bits (43), Expect = 8.7
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -2

Query: 628 HANYNFTGFHLS 593
           H NYN  G+H S
Sbjct: 385 HPNYNHYGYHYS 396


>AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 471

 Score = 21.4 bits (43), Expect = 8.7
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -2

Query: 628 HANYNFTGFHLS 593
           H NYN  G+H S
Sbjct: 333 HPNYNHYGYHYS 344


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 171,752
Number of Sequences: 336
Number of extensions: 3642
Number of successful extensions: 8
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 21895259
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -