BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_C16 (792 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1734.10c |||mRNA processing protein |Schizosaccharomyces pom... 26 5.4 SPBC23E6.09 |ssn6||transcriptional corepressor Ssn6|Schizosaccha... 26 7.1 SPBP4H10.11c |||long-chain-fatty-acid-CoA ligase |Schizosaccharo... 25 9.4 SPBC409.05 |skp1|psh1, sph1|SCF ubiquitin ligase complex subunit... 25 9.4 >SPBC1734.10c |||mRNA processing protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 332 Score = 26.2 bits (55), Expect = 5.4 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = -2 Query: 452 SRRPCATSIKRHDT-RTLSSWPPVTTFPILRTEWKAVDV 339 SR I R DT + + S PPVT ++ WKA+D+ Sbjct: 39 SRSTPINPIIRSDTIQLVISCPPVTYSDEIQVPWKAIDL 77 >SPBC23E6.09 |ssn6||transcriptional corepressor Ssn6|Schizosaccharomyces pombe|chr 2|||Manual Length = 1102 Score = 25.8 bits (54), Expect = 7.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 333 KHVISDPPDPLTVLLGTSSTGH 268 +H++ +PP PLTVL GH Sbjct: 499 RHILDNPPKPLTVLDIYFQIGH 520 >SPBP4H10.11c |||long-chain-fatty-acid-CoA ligase |Schizosaccharomyces pombe|chr 2|||Manual Length = 689 Score = 25.4 bits (53), Expect = 9.4 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +1 Query: 601 YTCIGHDGAYASFVECHLISKGHFTSP 681 Y +G DG Y S EC S+ FT P Sbjct: 156 YETLGEDGIYTSLDECK--SRAIFTDP 180 >SPBC409.05 |skp1|psh1, sph1|SCF ubiquitin ligase complex subunit Skp1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 161 Score = 25.4 bits (53), Expect = 9.4 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = +2 Query: 104 VANTNPSKSRASQNLPPXSETRPTEKIRRETQWA 205 + +P R + N+P E+IR+E +WA Sbjct: 125 IRGKSPEDIRKTFNIPNDFTPEEEEQIRKENEWA 158 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,807,801 Number of Sequences: 5004 Number of extensions: 53625 Number of successful extensions: 144 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 144 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 385381248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -