BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_C12 (805 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 45 3e-06 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 43 1e-05 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 40 1e-04 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 37 8e-04 AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcript... 33 0.010 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 32 0.018 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 31 0.031 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 31 0.042 AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 31 0.055 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 28 0.39 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 27 0.90 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 27 0.90 AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcrip... 26 1.6 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 25 2.7 EF519478-1|ABP73565.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519477-1|ABP73563.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519476-1|ABP73561.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519475-1|ABP73559.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519474-1|ABP73557.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519473-1|ABP73555.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519472-1|ABP73553.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519471-1|ABP73551.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519470-1|ABP73549.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519469-1|ABP73547.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519468-1|ABP73545.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519467-1|ABP73543.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519466-1|ABP73541.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519465-1|ABP73539.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519464-1|ABP73537.1| 160|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519463-1|ABP73535.1| 162|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519462-1|ABP73533.1| 147|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519461-1|ABP73531.1| 147|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519460-1|ABP73529.1| 157|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519459-1|ABP73527.1| 157|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519458-1|ABP73525.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519457-1|ABP73523.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519456-1|ABP73521.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519455-1|ABP73519.1| 163|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519454-1|ABP73517.1| 164|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519453-1|ABP73515.1| 163|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519452-1|ABP73513.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519451-1|ABP73511.1| 151|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519450-1|ABP73509.1| 151|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519449-1|ABP73507.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519448-1|ABP73505.1| 151|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519447-1|ABP73503.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519446-1|ABP73501.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519445-1|ABP73499.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519444-1|ABP73497.1| 154|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519443-1|ABP73495.1| 165|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519442-1|ABP73493.1| 162|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519441-1|ABP73491.1| 174|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519440-1|ABP73489.1| 174|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519439-1|ABP73487.1| 174|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519438-1|ABP73485.1| 164|Anopheles gambiae CTLMA2 protein. 25 3.6 EF519437-1|ABP73483.1| 147|Anopheles gambiae CTLMA2 protein. 25 3.6 AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. 25 3.6 AY524130-1|AAS17758.1| 211|Anopheles gambiae superoxide dismuta... 24 4.8 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 24 6.3 AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 24 6.3 AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific do... 23 8.3 AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doub... 23 8.3 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 44.8 bits (101), Expect = 3e-06 Identities = 22/75 (29%), Positives = 35/75 (46%) Frame = -2 Query: 804 HGCFGRYLXXSAGKSHTXGCHQCGHPDDDAQHALETCPRWEHSRRDLVAVLGRNLSLRAV 625 HGCF YL S + C C + +H L CPR+ R ++ G ++ + Sbjct: 890 HGCFRSYLHKYRHAS-SPDCPACVSIVESTEHVLFHCPRFAEERHEITVKCGTTINGTNL 948 Query: 624 VARMLEDQGSWEAMA 580 ML++ G+WE +A Sbjct: 949 TELMLKNAGTWEVIA 963 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 43.2 bits (97), Expect = 1e-05 Identities = 24/82 (29%), Positives = 35/82 (42%) Frame = -2 Query: 804 HGCFGRYLXXSAGKSHTXGCHQCGHPDDDAQHALETCPRWEHSRRDLVAVLGRNLSLRAV 625 HGCF YL ++ + C C D+ H + CPR+ R L + + Sbjct: 953 HGCFRSYLHRF-NRASSSRCPACKDEDETVDHVMFHCPRFAEERLQLNESCRVEVGCSNL 1011 Query: 624 VARMLEDQGSWEAMARFCDLVM 559 V ML+ SWEA A L++ Sbjct: 1012 VQVMLQHTDSWEAAATTMRLIL 1033 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 39.5 bits (88), Expect = 1e-04 Identities = 25/81 (30%), Positives = 37/81 (45%), Gaps = 2/81 (2%) Frame = -2 Query: 804 HGCFGRYLXXSAGKSHTXGCHQCGHPDDDAQHALETCPRWEHSRRDLVAVLGRNLSLRAV 625 HG F YL + G + + C C ++A HA+ CPR+ R + LG N V Sbjct: 990 HGFFREYLAIN-GFTESPDCRSCAGVPENAHHAIFECPRFARVRMEYFGELGPN----PV 1044 Query: 624 VARMLED--QGSWEAMARFCD 568 L+D GS + + FC+ Sbjct: 1045 TPDSLQDFLMGSQDNWSSFCE 1065 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 36.7 bits (81), Expect = 8e-04 Identities = 22/85 (25%), Positives = 38/85 (44%), Gaps = 1/85 (1%) Frame = -2 Query: 804 HGCFGRYLXXSAGKSHTXGCHQCGHPDDDAQHALETCPRWEHSRRDLVAV-LGRNLSLRA 628 HG F YL + G + + C +C + A+HA+ CPR+ R+ L+ + + Sbjct: 923 HGFFRDYLCRN-GFTSSPDCQRCSGVPETAEHAMFECPRFAEVRQQLLGEGITDPVRPEN 981 Query: 627 VVARMLEDQGSWEAMARFCDLVMAS 553 + +L D SW + + AS Sbjct: 982 LQQHLLRDAESWSRICEAAKRITAS 1006 >AB090818-2|BAC57912.1| 988|Anopheles gambiae reverse transcriptase protein. Length = 988 Score = 33.1 bits (72), Expect = 0.010 Identities = 15/64 (23%), Positives = 27/64 (42%) Frame = -2 Query: 804 HGCFGRYLXXSAGKSHTXGCHQCGHPDDDAQHALETCPRWEHSRRDLVAVLGRNLSLRAV 625 HG Y + C +CG +D +H L CPR + R ++ +++ + Sbjct: 919 HGFLRSYFVEKGILEGSPNCPECGDAVEDVEHVLFHCPRSDRIRNEMQQRCHSRVTMDNI 978 Query: 624 VARM 613 V+ M Sbjct: 979 VSEM 982 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 32.3 bits (70), Expect = 0.018 Identities = 33/111 (29%), Positives = 45/111 (40%), Gaps = 1/111 (0%) Frame = +3 Query: 45 PVRGG*RTGLCRTPAPPERKRGTRRSSTSPNSSQETTP*KRRAKHLPRRXXXXXXXXXXX 224 P RG R L R PP R ++ +P + +RRA RR Sbjct: 463 PARGHVRARLTRRTIPPTR---VAAAAAAPEGRR-----RRRAIARARRRRCRPRARRNP 514 Query: 225 XXXXXXIRYRSARRKSAFAGTRPDDKTGFHLRENPEGR-HFGRYTVGGAQE 374 +R+R RRKS G + DDK G+ R E R + RYT G ++ Sbjct: 515 PATTRPVRHRPTRRKSTKRG-KKDDK-GYDRRSGKEERSNDNRYTNGADRD 563 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 31.5 bits (68), Expect = 0.031 Identities = 20/82 (24%), Positives = 34/82 (41%) Frame = -2 Query: 804 HGCFGRYLXXSAGKSHTXGCHQCGHPDDDAQHALETCPRWEHSRRDLVAVLGRNLSLRAV 625 HG F +L G + C CG + A+H + C + +R L L + + Sbjct: 901 HGFFRSHLHRM-GYVPSPVCPACGDENQTAEHTIFICGMYLLTRLRLEQDLQADFDVENA 959 Query: 624 VARMLEDQGSWEAMARFCDLVM 559 + M D+ +W +A + VM Sbjct: 960 INIMCSDEVTWNRVAEYVHEVM 981 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 31.1 bits (67), Expect = 0.042 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = -2 Query: 804 HGCFGRYLXXSAGKSHTXGCHQCGHPDDDAQHALETCPRWEHSRRDLV 661 HG F +L S + C +C + A+HA+ CPR++ +R +L+ Sbjct: 998 HGFFREHLCGMQLTS-SPDCTRCPGVAESAEHAMFECPRFDSTRTELL 1044 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 30.7 bits (66), Expect = 0.055 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 1/76 (1%) Frame = -2 Query: 804 HGCFGRYLXXSAGKSHTXGCHQCGHPDDDAQHALETCPRWEHSRRDLVAVLGRN-LSLRA 628 HG F L G + + C +C + A+HA+ CPR+ R+ L+ + ++ Sbjct: 947 HGFFRDDLCRM-GFTPSPDCIRCTGVPETAEHAMFECPRFAEIRQKLLGEANTDAITPET 1005 Query: 627 VVARMLEDQGSWEAMA 580 + +L+ Q W +A Sbjct: 1006 LQFHLLQSQEKWSRIA 1021 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 27.9 bits (59), Expect = 0.39 Identities = 17/69 (24%), Positives = 30/69 (43%), Gaps = 1/69 (1%) Frame = -2 Query: 795 FGRYLXXSAGKSHTXGCHQCGHPDDDAQHALETCPRWEHSRRDLVAV-LGRNLSLRAVVA 619 F R G + + C C + H L CPR+ RRDL+ + + +++ + Sbjct: 931 FFREFLHVCGFAPSPECPACTGSVESVAHVLFYCPRFAEVRRDLLEMGVDGSITGENLGQ 990 Query: 618 RMLEDQGSW 592 +L+ SW Sbjct: 991 MLLKSSDSW 999 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 26.6 bits (56), Expect = 0.90 Identities = 15/51 (29%), Positives = 25/51 (49%) Frame = +3 Query: 513 KRDPTPFHAPQPHGTPLPGHKTWPWPPTSPDPLTCGRRQPAMRGFSPAPRR 665 + + P ++P G+P P +P P +P L+ G PA+ SP +R Sbjct: 1095 RSETEPDNSPMG-GSPRPETPAFPVTPRTPYGLSNGTSSPALPPKSPTSQR 1144 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 26.6 bits (56), Expect = 0.90 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +3 Query: 363 GAQEPPCTAPPPDRQSSTGRPRTRHLIVPTGAERELHAR 479 G + P C +PP R+S + RP + PT + L R Sbjct: 265 GGRWPSCRSPPARRRSRSTRPTSWPRSRPTSKPKRLPRR 303 >AJ438610-4|CAD27476.1| 593|Anopheles gambiae putative transcription factor protein. Length = 593 Score = 25.8 bits (54), Expect = 1.6 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +3 Query: 558 PLPGHKTWPWPPTSPDPLTCGRRQPAMRGFSPAPRRDLAASA 683 PLP + + P T PD C +Q A G S + A+S+ Sbjct: 63 PLPRPENFVEPETEPDSNKCSNQQLANTGSSNTQLQAAASSS 104 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 25.0 bits (52), Expect = 2.7 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +1 Query: 343 SGDTPWAAHRSHLAPPHHRTDSRVPGAPAPAT**SLRGLSGSFTP 477 SG+ A R + H+ + +PG P P RG G+F P Sbjct: 319 SGEKGQAGDRGQVGERGHKGEKGLPGQPGP------RGRDGNFGP 357 >EF519478-1|ABP73565.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALAGRPVL 112 >EF519477-1|ABP73563.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519476-1|ABP73561.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519475-1|ABP73559.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519474-1|ABP73557.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519473-1|ABP73555.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519472-1|ABP73553.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519471-1|ABP73551.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519470-1|ABP73549.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519469-1|ABP73547.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519468-1|ABP73545.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519467-1|ABP73543.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519466-1|ABP73541.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519465-1|ABP73539.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519464-1|ABP73537.1| 160|Anopheles gambiae CTLMA2 protein. Length = 160 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 95 GTYRWALTGRPVL 107 >EF519463-1|ABP73535.1| 162|Anopheles gambiae CTLMA2 protein. Length = 162 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 97 GTYRWALTGRPVL 109 >EF519462-1|ABP73533.1| 147|Anopheles gambiae CTLMA2 protein. Length = 147 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 82 GTYRWALTGRPVL 94 >EF519461-1|ABP73531.1| 147|Anopheles gambiae CTLMA2 protein. Length = 147 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 82 GTYRWALTGRPVL 94 >EF519460-1|ABP73529.1| 157|Anopheles gambiae CTLMA2 protein. Length = 157 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 92 GTYRWALTGRPVL 104 >EF519459-1|ABP73527.1| 157|Anopheles gambiae CTLMA2 protein. Length = 157 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 92 GTYRWALTGRPVL 104 >EF519458-1|ABP73525.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519457-1|ABP73523.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519456-1|ABP73521.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519455-1|ABP73519.1| 163|Anopheles gambiae CTLMA2 protein. Length = 163 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 98 GTYRWALTGRPVL 110 >EF519454-1|ABP73517.1| 164|Anopheles gambiae CTLMA2 protein. Length = 164 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 99 GTYRWALTGRPVL 111 >EF519453-1|ABP73515.1| 163|Anopheles gambiae CTLMA2 protein. Length = 163 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 98 GTYRWALTGRPVL 110 >EF519452-1|ABP73513.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519451-1|ABP73511.1| 151|Anopheles gambiae CTLMA2 protein. Length = 151 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 86 GTYRWALTGRPVL 98 >EF519450-1|ABP73509.1| 151|Anopheles gambiae CTLMA2 protein. Length = 151 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 86 GTYRWALTGRPVL 98 >EF519449-1|ABP73507.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519448-1|ABP73505.1| 151|Anopheles gambiae CTLMA2 protein. Length = 151 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 86 GTYRWALTGRPVL 98 >EF519447-1|ABP73503.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519446-1|ABP73501.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519445-1|ABP73499.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519444-1|ABP73497.1| 154|Anopheles gambiae CTLMA2 protein. Length = 154 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 89 GTYRWALTGRPVL 101 >EF519443-1|ABP73495.1| 165|Anopheles gambiae CTLMA2 protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 100 GTYRWALTGRPVL 112 >EF519442-1|ABP73493.1| 162|Anopheles gambiae CTLMA2 protein. Length = 162 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 97 GTYRWALTGRPVL 109 >EF519441-1|ABP73491.1| 174|Anopheles gambiae CTLMA2 protein. Length = 174 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 109 GTYRWALTGRPVL 121 >EF519440-1|ABP73489.1| 174|Anopheles gambiae CTLMA2 protein. Length = 174 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 109 GTYRWALTGRPVL 121 >EF519439-1|ABP73487.1| 174|Anopheles gambiae CTLMA2 protein. Length = 174 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 109 GTYRWALTGRPVL 121 >EF519438-1|ABP73485.1| 164|Anopheles gambiae CTLMA2 protein. Length = 164 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 99 GTYRWALTGRPVL 111 >EF519437-1|ABP73483.1| 147|Anopheles gambiae CTLMA2 protein. Length = 147 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 448 GTIRWRVRGRPVL 410 GT RW + GRPVL Sbjct: 82 GTYRWALTGRPVL 94 >AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. Length = 165 Score = 24.6 bits (51), Expect = 3.6 Identities = 20/67 (29%), Positives = 28/67 (41%) Frame = +1 Query: 235 HQTYGTAVRAESPPSPVPVLMIRRDFISGKIPKDVISGDTPWAAHRSHLAPPHHRTDSRV 414 HQT T V PP P+ V + R +G SG + ++ + P H T S Sbjct: 18 HQTLTTQVHPSQPPVPMLVPIPSRTASTG----SASSGHSGSSSLYDRV-PREHATSSPY 72 Query: 415 PGAPAPA 435 P+PA Sbjct: 73 HAPPSPA 79 >AY524130-1|AAS17758.1| 211|Anopheles gambiae superoxide dismutase 2 protein. Length = 211 Score = 24.2 bits (50), Expect = 4.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +1 Query: 550 TGRHYQVTKPGHGLPRALIL*HAGD 624 TG HY K HG P + H GD Sbjct: 79 TGGHYNPDKVSHGAPNDQVR-HVGD 102 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.8 bits (49), Expect = 6.3 Identities = 19/67 (28%), Positives = 21/67 (31%) Frame = +3 Query: 366 AQEPPCTAPPPDRQSSTGRPRTRHLIVPTGAERELHARAGHPAFRAEVLKRDPTPFHAPQ 545 AQ PP PPP L P G+ L G V P P P Sbjct: 579 AQPPPAPPPPPPMGPPPSPLAGGPLGGPAGSRPPLPNLLGFGGAAPPVTILVPYPIIIPL 638 Query: 546 PHGTPLP 566 P P+P Sbjct: 639 PLPIPVP 645 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.8 bits (49), Expect = 6.3 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 658 RDEISPRVLPTRARFERVLR 717 +D++ PRVL + A+F VL+ Sbjct: 177 KDKVGPRVLESAAKFCEVLK 196 >AY903308-1|AAX48940.1| 241|Anopheles gambiae female-specific doublesex protein protein. Length = 241 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 588 PPTSPDPLTCGRRQPAMRGFSPAPR 662 P TS PLT RR P + P P+ Sbjct: 124 PGTSSVPLTIHRRSPGVPHHVPEPQ 148 >AY903307-1|AAX48939.1| 283|Anopheles gambiae male-specific doublesex protein protein. Length = 283 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 588 PPTSPDPLTCGRRQPAMRGFSPAPR 662 P TS PLT RR P + P P+ Sbjct: 124 PGTSSVPLTIHRRSPGVPHHVPEPQ 148 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 903,785 Number of Sequences: 2352 Number of extensions: 22400 Number of successful extensions: 111 Number of sequences better than 10.0: 62 Number of HSP's better than 10.0 without gapping: 102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84823812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -