BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_C10 (834 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxyge... 23 2.3 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 23 2.3 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 23 2.3 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 23 3.9 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 9.1 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 9.1 >AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxygenase protein. Length = 135 Score = 23.4 bits (48), Expect = 2.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 172 FRCDLDGHRPADGRQLTLLRVLDVGEGLRQD 264 FRC L RPA G Q R+L+ G+RQ+ Sbjct: 63 FRCYL---RPASGFQSLQFRLLENKLGVRQE 90 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 23.4 bits (48), Expect = 2.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 172 FRCDLDGHRPADGRQLTLLRVLDVGEGLRQD 264 FRC L RPA G Q R+L+ G+RQ+ Sbjct: 123 FRCYL---RPASGFQSLQFRLLENKLGVRQE 150 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 23.4 bits (48), Expect = 2.3 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +1 Query: 172 FRCDLDGHRPADGRQLTLLRVLDVGEGLRQD 264 FRC L RPA G Q R+L+ G+RQ+ Sbjct: 123 FRCYL---RPASGFQSLQFRLLENKLGVRQE 150 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 22.6 bits (46), Expect = 3.9 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +1 Query: 193 HRPADGRQLTLLRVLDVGEGLRQDLQAVDA 282 H G +L L G+GL +DLQ + A Sbjct: 158 HTKGIGAKLLLQMGFQPGKGLGKDLQGISA 187 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 9.1 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +3 Query: 414 PAAGPGERGD 443 P+AGPGE G+ Sbjct: 887 PSAGPGEAGE 896 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 303 VSAYHRARVYGLKILTEPFA 244 V+AY V LKI PFA Sbjct: 181 VTAYQNEEVTALKIKYNPFA 200 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,256 Number of Sequences: 336 Number of extensions: 1747 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22932949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -