BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_C10 (834 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_05_0062 + 18749405-18749449,18751328-18751465,18752625-187526... 30 2.0 02_01_0072 - 502785-504038 28 8.0 >11_05_0062 + 18749405-18749449,18751328-18751465,18752625-18752675, 18752905-18753014,18753483-18753522,18753758-18753807, 18754066-18754114,18754212-18754256 Length = 175 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = -1 Query: 354 AALLVCYVALRFLGTNTVSAYHRARVYGLKILTEPFADVQDSE 226 AA LV YV++ FL TV Y V GL++ ++D E Sbjct: 100 AANLVLYVSIHFLSKLTVQPYKGGSVVGLRMEDNMMYPIKDQE 142 >02_01_0072 - 502785-504038 Length = 417 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -3 Query: 481 VHVVAXGRAPRPLSPRSPGPAAGAWALAQLYPSS 380 VH +A AP P SP S P AG LY S Sbjct: 199 VHAMAAHLAPPPQSPTSASPGAGCGLGLALYTMS 232 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,047,402 Number of Sequences: 37544 Number of extensions: 238348 Number of successful extensions: 666 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 666 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2303447664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -