BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_C08 (871 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1773.11c |mug89||CDC50 domain protein|Schizosaccharomyces po... 26 8.0 SPAC18G6.11c |rrn3||ribosomal DNA |Schizosaccharomyces pombe|chr... 26 8.0 >SPBC1773.11c |mug89||CDC50 domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 396 Score = 25.8 bits (54), Expect = 8.0 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -1 Query: 244 GATCGPXGGRVLQKSQLDEDSRVDYVVCD 158 G GP GG +L S + ++ VDY C+ Sbjct: 54 GIIFGPLGGGLLYASSIVQELVVDYTDCE 82 >SPAC18G6.11c |rrn3||ribosomal DNA |Schizosaccharomyces pombe|chr 1|||Manual Length = 599 Score = 25.8 bits (54), Expect = 8.0 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -1 Query: 193 DEDSRVDYVVCDDGAAPRIKGRAVTAAWLWKCH 95 D+D D VV DD +TA+ L++ H Sbjct: 254 DDDEEEDEVVTDDDGTSNADSEVITASTLYERH 286 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,076,886 Number of Sequences: 5004 Number of extensions: 26668 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 434475230 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -