BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_C08 (871 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 25 1.2 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 22 6.4 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 24.6 bits (51), Expect = 1.2 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 4/32 (12%) Frame = -1 Query: 157 DGAAPRIKGRAVTAAWLW----KCHQQRKLCP 74 DGAA + K R + +LW K Q R+ CP Sbjct: 444 DGAAVKRKSREGSTTYLWEFLLKLLQDREYCP 475 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.2 bits (45), Expect = 6.4 Identities = 12/38 (31%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -2 Query: 144 RESRAAPSLQPGCGN-VINNENCVQYNDSSTCEFLSLN 34 RE P + N I+N N +YN ++ C+ L N Sbjct: 73 RERSREPKIISSLSNKTIHNNNNYKYNYNNNCKKLYYN 110 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,624 Number of Sequences: 438 Number of extensions: 2450 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28159464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -