BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_C06 (806 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.9 U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 22 7.7 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.8 bits (49), Expect = 1.9 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 398 SIRSSWRIPYSPNFVEARFVAQY 466 S++ SW PY N R+V +Y Sbjct: 891 SVQLSWAAPYDGNSPIKRYVIEY 913 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 21.8 bits (44), Expect = 7.7 Identities = 11/42 (26%), Positives = 18/42 (42%) Frame = -1 Query: 512 LVASVPRRSWTERWTDIEQRTWLLQSSGNTEFATKI**RLWL 387 L+ S+ + +W D+ T L + F T + R WL Sbjct: 79 LLCSIAGGTSESQWEDVTGSTPLTFVNDTVSFTTTVSARFWL 120 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 206,917 Number of Sequences: 438 Number of extensions: 4135 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25610547 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -