BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_C05 (815 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29B12.14c |||purine transporter |Schizosaccharomyces pombe|c... 29 0.79 SPAC1399.03 |fur4||uracil permease|Schizosaccharomyces pombe|chr... 27 3.2 SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces p... 26 5.6 SPBC651.07 |csa1||sequence orphan|Schizosaccharomyces pombe|chr ... 26 7.4 SPBC2G2.14 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||... 26 7.4 >SPAC29B12.14c |||purine transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 581 Score = 29.1 bits (62), Expect = 0.79 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 188 ALAWGWPWWEAWCTRWEG 135 A+ G WWEAW T W G Sbjct: 79 AVESGLSWWEAWITVWVG 96 >SPAC1399.03 |fur4||uracil permease|Schizosaccharomyces pombe|chr 1|||Manual Length = 581 Score = 27.1 bits (57), Expect = 3.2 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = -1 Query: 188 ALAWGWPWWEAWCTRWEG 135 A+ G WWEAW W G Sbjct: 81 AIELGLNWWEAWICVWVG 98 >SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces pombe|chr 3|||Manual Length = 647 Score = 26.2 bits (55), Expect = 5.6 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 304 PHAAPNGAPGCRQGGTGAPRLAPI 375 P AAP APG GG P + + Sbjct: 623 PGAAPGAAPGAAPGGDNGPEVEEV 646 >SPBC651.07 |csa1||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 268 Score = 25.8 bits (54), Expect = 7.4 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Frame = +2 Query: 566 PMMYRFSPPGSTX-APAYDSARGSFAFACHEAVLQSP---DRVQFC 691 P++ S P ST AP S R AC++AVL +R++ C Sbjct: 36 PIVQTLSIPSSTSSAPLVTSVREILELACNDAVLDKSFLNERLEHC 81 >SPBC2G2.14 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 533 Score = 25.8 bits (54), Expect = 7.4 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 545 LTPPAQPPMMYRFSPPGS 598 LTP + PP +RF PP S Sbjct: 120 LTPASAPPPRFRFVPPKS 137 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,169,845 Number of Sequences: 5004 Number of extensions: 64238 Number of successful extensions: 245 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 221 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 245 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 398435810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -