BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_B24 (813 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15888| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_48726| Best HMM Match : E1-E2_ATPase (HMM E-Value=7.7e-07) 29 4.5 >SB_15888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2437 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = -1 Query: 585 FAPGLKPPLSSEAPSAYLTPSSLDMXKGVSPPYFQVNDESQASRLISR 442 FA P SS++PSA +P+S SP F + E + +IS+ Sbjct: 1096 FATTTMSPTSSQSPSAVTSPTSPRSPSNPSPASFGFHSEDEPVTMISK 1143 >SB_48726| Best HMM Match : E1-E2_ATPase (HMM E-Value=7.7e-07) Length = 592 Score = 29.1 bits (62), Expect = 4.5 Identities = 29/98 (29%), Positives = 43/98 (43%), Gaps = 3/98 (3%) Frame = -2 Query: 356 YKVKIADNNLVTHKELALKVSSIIGTRVYVFDPSCYFSTPPFDTVLYDNIRTXXK---DN 186 + + + DN L T L +K+ G +VFD FDT+ +R + DN Sbjct: 313 HSLTMIDNEL-TGDPLDIKMFEATG---WVFDEPGE-DNKKFDTIAPSTVRPKTREMTDN 367 Query: 185 KTALLSASIQASLPSSEIYRQLVDPRHVSSDSFGVYVK 72 + L I+ SS++ R V R + SD VYVK Sbjct: 368 QVPLEVGIIRQFPFSSDVQRMTVITRILGSDHMDVYVK 405 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,680,372 Number of Sequences: 59808 Number of extensions: 429252 Number of successful extensions: 978 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 905 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 975 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2263654701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -