BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_B24 (813 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 27 0.52 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 25 3.7 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 25 3.7 AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 23 8.5 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 27.5 bits (58), Expect = 0.52 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +2 Query: 44 QNCEE*GIKILRRLQRSRKKHGEDLPTGGRSRRKGEKLE 160 Q EE I I Q ++ G+ P G S+++GEK+E Sbjct: 94 QKNEERSIPITHTGQPMKQVTGKAAPENGHSKKEGEKME 132 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 24.6 bits (51), Expect = 3.7 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -1 Query: 219 VRQHQDXX*GQQNCSSLCIYSSFSPFLRDLPPVGRSSPCFFRL 91 +R+H GQ C+ Y++ P R PV PC+ R+ Sbjct: 1822 LRKHHCRSCGQIFCAECSDYTAHLPEERLYQPVRLCGPCYQRI 1864 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 24.6 bits (51), Expect = 3.7 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -1 Query: 219 VRQHQDXX*GQQNCSSLCIYSSFSPFLRDLPPVGRSSPCFFRL 91 +R+H GQ C+ Y++ P R PV PC+ R+ Sbjct: 1823 LRKHHCRSCGQIFCAECSDYTAHLPEERLYQPVRLCGPCYQRI 1865 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 23.4 bits (48), Expect = 8.5 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +2 Query: 551 SDDNGGFNPGANSFXYGVRG 610 S+DNGG+ G + + G RG Sbjct: 51 SNDNGGYGGGDDGYGGGGRG 70 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 743,524 Number of Sequences: 2352 Number of extensions: 12785 Number of successful extensions: 19 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86071221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -