BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_B24 (813 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY113445-1|AAM29450.1| 1524|Drosophila melanogaster RE29777p pro... 29 10.0 AE013599-2523|AAF57823.2| 1524|Drosophila melanogaster CG10936-P... 29 10.0 AE013599-2522|AAM68482.1| 1524|Drosophila melanogaster CG10936-P... 29 10.0 >AY113445-1|AAM29450.1| 1524|Drosophila melanogaster RE29777p protein. Length = 1524 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = -1 Query: 588 EFAPGLKPPLSSEAPSAY--LTPSSLDMXKGVSPPYFQVN-DESQAS 457 + PG K P + P +TP +D K + PP F++N ES AS Sbjct: 959 QLPPGYKAPEPKDEPKLPPGVTPIKIDSLKDLLPPGFKLNVTESDAS 1005 >AE013599-2523|AAF57823.2| 1524|Drosophila melanogaster CG10936-PB, isoform B protein. Length = 1524 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = -1 Query: 588 EFAPGLKPPLSSEAPSAY--LTPSSLDMXKGVSPPYFQVN-DESQAS 457 + PG K P + P +TP +D K + PP F++N ES AS Sbjct: 959 QLPPGYKAPEPKDEPKLPPGVTPIKIDSLKDLLPPGFKLNVTESDAS 1005 >AE013599-2522|AAM68482.1| 1524|Drosophila melanogaster CG10936-PA, isoform A protein. Length = 1524 Score = 28.7 bits (61), Expect = 10.0 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = -1 Query: 588 EFAPGLKPPLSSEAPSAY--LTPSSLDMXKGVSPPYFQVN-DESQAS 457 + PG K P + P +TP +D K + PP F++N ES AS Sbjct: 959 QLPPGYKAPEPKDEPKLPPGVTPIKIDSLKDLLPPGFKLNVTESDAS 1005 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,669,234 Number of Sequences: 53049 Number of extensions: 663725 Number of successful extensions: 1563 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1563 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3818998872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -