BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_B21 (823 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U67734-1|AAD00163.1| 461|Homo sapiens cPLA2 interacting protein... 32 2.2 BC093032-1|AAH93032.1| 461|Homo sapiens HIV-1 Tat interacting p... 32 2.2 BC000166-1|AAH00166.3| 457|Homo sapiens HTATIP protein protein. 32 2.2 AB209813-1|BAD93050.1| 448|Homo sapiens HIV-1 Tat interactive p... 32 2.2 BC105598-1|AAI05599.1| 259|Homo sapiens DDX46 protein protein. 32 2.9 BC012304-1|AAH12304.1| 1031|Homo sapiens DEAD (Asp-Glu-Ala-Asp) ... 32 2.9 AB018344-1|BAA34521.2| 1058|Homo sapiens KIAA0801 protein protein. 32 2.9 X54162-1|CAA38101.1| 572|Homo sapiens 64 Kd autoantigen protein. 31 5.0 BC080187-1|AAH80187.1| 600|Homo sapiens leiomodin 1 (smooth mus... 31 5.0 AL513217-2|CAH72278.1| 631|Homo sapiens leiomodin 1 (smooth mus... 31 5.0 BC030525-1|AAH30525.1| 55|Homo sapiens Unknown (protein for MG... 31 6.7 AF201422-1|AAF21439.1| 2296|Homo sapiens splicing coactivator su... 31 6.7 AC004493-2|AAC08453.1| 1791|Homo sapiens KIAA0324 protein. 31 6.7 AB016092-1|BAA83718.1| 2752|Homo sapiens RNA binding protein pro... 31 6.7 AB016091-1|BAA83717.1| 1275|Homo sapiens RNA binding protein pro... 31 6.7 AB002322-1|BAA20782.3| 2800|Homo sapiens KIAA0324 protein protein. 31 6.7 AF106680-1|AAD43033.1| 1031|Homo sapiens RNA helicase protein. 30 8.8 >U67734-1|AAD00163.1| 461|Homo sapiens cPLA2 interacting protein protein. Length = 461 Score = 32.3 bits (70), Expect = 2.2 Identities = 20/64 (31%), Positives = 36/64 (56%) Frame = -2 Query: 675 KLDXYIYIESHKGLDGTQVAFPKVRAKKSKDSPVPRKRRKVDAPEANERQLRSRGKRSTP 496 +LD ++ +H+ LD ++ FPK AK + +P R P + ER+++ + + +P Sbjct: 53 RLDEWV---THERLDLKKIQFPKKEAKTPTKNGLPGSR-----PGSPEREVKRKVEVVSP 104 Query: 495 ATPV 484 ATPV Sbjct: 105 ATPV 108 >BC093032-1|AAH93032.1| 461|Homo sapiens HIV-1 Tat interacting protein, 60kDa protein. Length = 461 Score = 32.3 bits (70), Expect = 2.2 Identities = 20/64 (31%), Positives = 36/64 (56%) Frame = -2 Query: 675 KLDXYIYIESHKGLDGTQVAFPKVRAKKSKDSPVPRKRRKVDAPEANERQLRSRGKRSTP 496 +LD ++ +H+ LD ++ FPK AK + +P R P + ER+++ + + +P Sbjct: 53 RLDEWV---THERLDLKKIQFPKKEAKTPTKNGLPGSR-----PGSPEREVKRKVEVVSP 104 Query: 495 ATPV 484 ATPV Sbjct: 105 ATPV 108 >BC000166-1|AAH00166.3| 457|Homo sapiens HTATIP protein protein. Length = 457 Score = 32.3 bits (70), Expect = 2.2 Identities = 20/64 (31%), Positives = 36/64 (56%) Frame = -2 Query: 675 KLDXYIYIESHKGLDGTQVAFPKVRAKKSKDSPVPRKRRKVDAPEANERQLRSRGKRSTP 496 +LD ++ +H+ LD ++ FPK AK + +P R P + ER+++ + + +P Sbjct: 49 RLDEWV---THERLDLKKIQFPKKEAKTPTKNGLPGSR-----PGSPEREVKRKVEVVSP 100 Query: 495 ATPV 484 ATPV Sbjct: 101 ATPV 104 >AB209813-1|BAD93050.1| 448|Homo sapiens HIV-1 Tat interactive protein, 60kDa isoform 3 variant protein. Length = 448 Score = 32.3 bits (70), Expect = 2.2 Identities = 20/64 (31%), Positives = 36/64 (56%) Frame = -2 Query: 675 KLDXYIYIESHKGLDGTQVAFPKVRAKKSKDSPVPRKRRKVDAPEANERQLRSRGKRSTP 496 +LD ++ +H+ LD ++ FPK AK + +P R P + ER+++ + + +P Sbjct: 40 RLDEWV---THERLDLKKIQFPKKEAKTPTKNGLPGSR-----PGSPEREVKRKVEVVSP 91 Query: 495 ATPV 484 ATPV Sbjct: 92 ATPV 95 >BC105598-1|AAI05599.1| 259|Homo sapiens DDX46 protein protein. Length = 259 Score = 31.9 bits (69), Expect = 2.9 Identities = 17/71 (23%), Positives = 39/71 (54%) Frame = -2 Query: 609 KVRAKKSKDSPVPRKRRKVDAPEANERQLRSRGKRSTPATPVVEKPRKGRR*SHQGVDRE 430 ++R +S++ R+RR+ + + + RSRG+RS ++P K ++ ++ +E Sbjct: 67 RLRRSRSRERDRSRERRRSRSRDRRRSRSRSRGRRSRSSSP----GNKSKKTENRSRSKE 122 Query: 429 RKNGPRHSQEE 397 + +G S+E+ Sbjct: 123 KTDGGESSKEK 133 >BC012304-1|AAH12304.1| 1031|Homo sapiens DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 protein. Length = 1031 Score = 31.9 bits (69), Expect = 2.9 Identities = 17/71 (23%), Positives = 39/71 (54%) Frame = -2 Query: 609 KVRAKKSKDSPVPRKRRKVDAPEANERQLRSRGKRSTPATPVVEKPRKGRR*SHQGVDRE 430 ++R +S++ R+RR+ + + + RSRG+RS ++P K ++ ++ +E Sbjct: 67 RLRRSRSRERDRSRERRRSRSRDRRRSRSRSRGRRSRSSSP----GNKSKKTENRSRSKE 122 Query: 429 RKNGPRHSQEE 397 + +G S+E+ Sbjct: 123 KTDGGESSKEK 133 >AB018344-1|BAA34521.2| 1058|Homo sapiens KIAA0801 protein protein. Length = 1058 Score = 31.9 bits (69), Expect = 2.9 Identities = 17/71 (23%), Positives = 39/71 (54%) Frame = -2 Query: 609 KVRAKKSKDSPVPRKRRKVDAPEANERQLRSRGKRSTPATPVVEKPRKGRR*SHQGVDRE 430 ++R +S++ R+RR+ + + + RSRG+RS ++P K ++ ++ +E Sbjct: 93 RLRRSRSRERDRSRERRRSRSRDRRRSRSRSRGRRSRSSSP----GNKSKKTENRSRSKE 148 Query: 429 RKNGPRHSQEE 397 + +G S+E+ Sbjct: 149 KTDGGESSKEK 159 >X54162-1|CAA38101.1| 572|Homo sapiens 64 Kd autoantigen protein. Length = 572 Score = 31.1 bits (67), Expect = 5.0 Identities = 18/67 (26%), Positives = 28/67 (41%) Frame = -2 Query: 600 AKKSKDSPVPRKRRKVDAPEANERQLRSRGKRSTPATPVVEKPRKGRR*SHQGVDRERKN 421 AKK D V +RR D + E+ R+ G K G + + ++ +KN Sbjct: 187 AKKEDDEKVKGERRNTDTRKEGEKMKRAGGNTDMKKEDEKVKRGTGNTDTKKDDEKVKKN 246 Query: 420 GPRHSQE 400 P H +E Sbjct: 247 EPLHEKE 253 >BC080187-1|AAH80187.1| 600|Homo sapiens leiomodin 1 (smooth muscle) protein. Length = 600 Score = 31.1 bits (67), Expect = 5.0 Identities = 18/67 (26%), Positives = 28/67 (41%) Frame = -2 Query: 600 AKKSKDSPVPRKRRKVDAPEANERQLRSRGKRSTPATPVVEKPRKGRR*SHQGVDRERKN 421 AKK D V +RR D + E+ R+ G K G + + ++ +KN Sbjct: 215 AKKEDDEKVKGERRNTDTRKEGEKMKRAGGNTDMKKEDEKVKRGTGNTDTKKDDEKVKKN 274 Query: 420 GPRHSQE 400 P H +E Sbjct: 275 EPLHEKE 281 >AL513217-2|CAH72278.1| 631|Homo sapiens leiomodin 1 (smooth muscle) protein. Length = 631 Score = 31.1 bits (67), Expect = 5.0 Identities = 18/67 (26%), Positives = 28/67 (41%) Frame = -2 Query: 600 AKKSKDSPVPRKRRKVDAPEANERQLRSRGKRSTPATPVVEKPRKGRR*SHQGVDRERKN 421 AKK D V +RR D + E+ R+ G K G + + ++ +KN Sbjct: 215 AKKEDDEKVKGERRNTDTRKEGEKMKRAGGNTDMKKEDEKVKRGTGNTDTKKDDEKVKKN 274 Query: 420 GPRHSQE 400 P H +E Sbjct: 275 EPLHEKE 281 >BC030525-1|AAH30525.1| 55|Homo sapiens Unknown (protein for MGC:40524) protein. Length = 55 Score = 30.7 bits (66), Expect = 6.7 Identities = 13/47 (27%), Positives = 27/47 (57%) Frame = -1 Query: 367 REKGQNGRATRQASERKTIKAKKKETLTLNQQEDQMRMTRSRKRRLE 227 R +G+ + R+ ++K K KKK+ +++ + R R R+RR++ Sbjct: 8 RRRGRGKKKKRKRKKKKKKKKKKKKKKKKKKKKKRRRRRRGRRRRMQ 54 >AF201422-1|AAF21439.1| 2296|Homo sapiens splicing coactivator subunit SRm300 protein. Length = 2296 Score = 30.7 bits (66), Expect = 6.7 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -2 Query: 603 RAKKSKDSPVPRKRRKVDAPEANERQLRSR----GKRSTPATPVVEKPRKGRR 457 R +S+ SPV R+R + P R+ RSR +RS TP V + R R Sbjct: 1909 RRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSR 1961 >AC004493-2|AAC08453.1| 1791|Homo sapiens KIAA0324 protein. Length = 1791 Score = 30.7 bits (66), Expect = 6.7 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -2 Query: 603 RAKKSKDSPVPRKRRKVDAPEANERQLRSR----GKRSTPATPVVEKPRKGRR 457 R +S+ SPV R+R + P R+ RSR +RS TP V + R R Sbjct: 941 RRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSR 993 >AB016092-1|BAA83718.1| 2752|Homo sapiens RNA binding protein protein. Length = 2752 Score = 30.7 bits (66), Expect = 6.7 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -2 Query: 603 RAKKSKDSPVPRKRRKVDAPEANERQLRSR----GKRSTPATPVVEKPRKGRR 457 R +S+ SPV R+R + P R+ RSR +RS TP V + R R Sbjct: 1909 RRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSR 1961 >AB016091-1|BAA83717.1| 1275|Homo sapiens RNA binding protein protein. Length = 1275 Score = 30.7 bits (66), Expect = 6.7 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -2 Query: 603 RAKKSKDSPVPRKRRKVDAPEANERQLRSR----GKRSTPATPVVEKPRKGRR 457 R +S+ SPV R+R + P R+ RSR +RS TP V + R R Sbjct: 432 RRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSR 484 >AB002322-1|BAA20782.3| 2800|Homo sapiens KIAA0324 protein protein. Length = 2800 Score = 30.7 bits (66), Expect = 6.7 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -2 Query: 603 RAKKSKDSPVPRKRRKVDAPEANERQLRSR----GKRSTPATPVVEKPRKGRR 457 R +S+ SPV R+R + P R+ RSR +RS TP V + R R Sbjct: 1957 RRSRSRASPVSRRRSRSRTPPVTRRRSRSRTPTTRRRSRSRTPPVTRRRSRSR 2009 >AF106680-1|AAD43033.1| 1031|Homo sapiens RNA helicase protein. Length = 1031 Score = 30.3 bits (65), Expect = 8.8 Identities = 17/71 (23%), Positives = 38/71 (53%) Frame = -2 Query: 609 KVRAKKSKDSPVPRKRRKVDAPEANERQLRSRGKRSTPATPVVEKPRKGRR*SHQGVDRE 430 ++R +S++ R+RR+ + + + RSRG+RS ++P K ++ ++ +E Sbjct: 67 RLRRSRSRERDRSRERRRSRSRDRRRSRSRSRGRRSRSSSP----GSKSKKAENRSRSKE 122 Query: 429 RKNGPRHSQEE 397 + G S+E+ Sbjct: 123 KAEGGDSSKEK 133 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,579,310 Number of Sequences: 237096 Number of extensions: 1768769 Number of successful extensions: 6503 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 5724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6432 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10259383312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -