BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_B13 (827 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 24 1.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.2 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 23 3.9 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 23.8 bits (49), Expect = 1.7 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -1 Query: 272 LPEWSCEQSAWWGACGR 222 L +++CE WW C R Sbjct: 50 LKQYTCELKLWWEFCQR 66 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 2.2 Identities = 6/18 (33%), Positives = 10/18 (55%) Frame = -1 Query: 269 PEWSCEQSAWWGACGRVP 216 P+W+ + S WW + P Sbjct: 1033 PDWTTKPSTWWSSTTTSP 1050 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.6 bits (46), Expect = 3.9 Identities = 9/34 (26%), Positives = 14/34 (41%) Frame = -2 Query: 700 LCPSAVQKPXPWPRWEAXRGNVPXFLSGXRXPGH 599 +CP + K W + G VP G + G+ Sbjct: 312 ICPEILNKDSGWTKKWDEHGKVPYAYKGNQWVGY 345 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,030 Number of Sequences: 336 Number of extensions: 1612 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22725411 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -