BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_A19 (785 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 25 0.69 AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 24 1.2 AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory recept... 24 1.2 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 22 4.8 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 22 4.8 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 4.8 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 4.8 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 21 8.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.4 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 25.0 bits (52), Expect = 0.69 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = -3 Query: 135 PQQPTDNAQCTALGMST--TDCVCRRETYINMLIKSY 31 P+QP D A CT L T V T N +IK Y Sbjct: 1100 PEQPPDKATCTTLTAQTIRVSWVSPPLTAANGVIKGY 1136 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 24.2 bits (50), Expect = 1.2 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -1 Query: 392 SFWDKDARTKLKSTELLDQSLTKCAFNHSGQIFAYAV 282 SF D D + KL+ E + SL C G IFA V Sbjct: 78 SFKDSDLQQKLRYFEEVFSSLLSCCSVIFGCIFALKV 114 >AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory receptor candidate 21 protein. Length = 386 Score = 24.2 bits (50), Expect = 1.2 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -1 Query: 392 SFWDKDARTKLKSTELLDQSLTKCAFNHSGQIFAYAV 282 SF D D + KL+ E + SL C G IFA V Sbjct: 78 SFKDSDLQQKLRYFEEVFSSLLSCCSVIFGCIFALKV 114 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 302 QIFAYAVGYDWSKGHEH 252 Q+F YAVG+ K EH Sbjct: 203 QMFEYAVGHWMQKATEH 219 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 302 QIFAYAVGYDWSKGHEH 252 Q+F YAVG+ K EH Sbjct: 517 QMFEYAVGHWMQKATEH 533 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 302 QIFAYAVGYDWSKGHEH 252 Q+F YAVG+ K EH Sbjct: 750 QMFEYAVGHWMQKATEH 766 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 4.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -1 Query: 302 QIFAYAVGYDWSKGHEH 252 Q+F YAVG+ K EH Sbjct: 750 QMFEYAVGHWMQKATEH 766 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 559 TRPSTLPSAKPV 594 T+PST P+ KPV Sbjct: 179 TKPSTKPTNKPV 190 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 302 QIFAYAVGYDWSKGHEH 252 Q+F YA+G+ K EH Sbjct: 777 QMFEYAIGHWLQKATEH 793 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 302 QIFAYAVGYDWSKGHEH 252 Q+F YA+G+ K EH Sbjct: 777 QMFEYAIGHWLQKATEH 793 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 302 QIFAYAVGYDWSKGHEH 252 Q+F YA+G+ K EH Sbjct: 777 QMFEYAIGHWLQKATEH 793 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -1 Query: 302 QIFAYAVGYDWSKGHEH 252 Q+F YA+G+ K EH Sbjct: 777 QMFEYAIGHWLQKATEH 793 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,279 Number of Sequences: 336 Number of extensions: 2781 Number of successful extensions: 14 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21272645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -