BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_A19 (785 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 26 1.1 AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein ... 25 2.7 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 25 3.5 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 24 4.6 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 8.1 AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CY... 23 8.1 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 26.2 bits (55), Expect = 1.1 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 630 VSIFQGQEEQAADGLRAGQRGGPRGHPV 547 VSI + ++AAD L+ G+ GP G P+ Sbjct: 391 VSISADEIQKAADHLKLGKAPGPDGIPI 418 >AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein protein. Length = 705 Score = 25.0 bits (52), Expect = 2.7 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +1 Query: 505 HLNVKLSLGLVGFTYWMATRPST 573 H ++L++ V F +W+ TRP T Sbjct: 375 HFLLQLTIVAVLFAHWLTTRPPT 397 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 24.6 bits (51), Expect = 3.5 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = -3 Query: 591 GLRAGQRGGPRGHPVREPDQPQGQLHVQVPPDHGSGGRLPG 469 GL R GPRG P G+ VQV P + PG Sbjct: 1246 GLNLLIRAGPRGQPGHRAVNIGGKTAVQVGPGDIFSMKTPG 1286 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 24.2 bits (50), Expect = 4.6 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +1 Query: 550 WMATRPSTLPSAKPVGCLLFL 612 W+ R +++PSAK V +FL Sbjct: 433 WLNDRDASIPSAKEVNPFIFL 453 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 8.1 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = -3 Query: 579 GQRGGPRGHPVREPDQPQGQLHVQVPP 499 G G P G P P G L +VPP Sbjct: 1327 GGEGVPMGPANAAPSSPAGVLVAKVPP 1353 >AY176050-1|AAO19581.1| 522|Anopheles gambiae cytochrome P450 CYP12F2 protein. Length = 522 Score = 23.4 bits (48), Expect = 8.1 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +1 Query: 550 WMATRPSTLPSAKPVGCLLFL 612 W++ RP+ +PS K +FL Sbjct: 440 WLSERPADVPSVKDSNPFIFL 460 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 631,481 Number of Sequences: 2352 Number of extensions: 11163 Number of successful extensions: 31 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 82328994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -