BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_A19 (785 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g80670.1 68414.m09466 transducin family protein / WD-40 repea... 146 1e-35 At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic c... 95 6e-20 At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic c... 87 2e-17 At1g69400.1 68414.m07969 transducin family protein / WD-40 repea... 63 2e-10 At1g69400.2 68414.m07968 transducin family protein / WD-40 repea... 38 0.008 At3g16830.1 68416.m02149 WD-40 repeat family protein contains 10... 32 0.38 At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuc... 32 0.50 At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p... 31 0.66 At5g27030.1 68418.m03224 WD-40 repeat family protein contains 8 ... 30 1.5 At4g29860.1 68417.m04250 transducin family protein / WD-40 repea... 30 1.5 At2g31300.1 68415.m03821 transducin family protein / WD-40 repea... 30 1.5 At2g30910.1 68415.m03767 transducin family protein / WD-40 repea... 30 1.5 At5g64630.2 68418.m08122 transducin family protein / WD-40 repea... 30 2.0 At5g64630.1 68418.m08121 transducin family protein / WD-40 repea... 30 2.0 At3g21060.1 68416.m02662 transducin family protein / WD-40 repea... 29 2.6 At3g18140.1 68416.m02306 transducin family protein / WD-40 repea... 29 2.6 At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p... 29 2.6 At2g37160.1 68415.m04559 transducin family protein / WD-40 repea... 29 3.5 At5g35960.1 68418.m04330 protein kinase, putative contains prote... 29 4.6 At2g30910.2 68415.m03768 transducin family protein / WD-40 repea... 28 6.1 >At1g80670.1 68414.m09466 transducin family protein / WD-40 repeat family protein contains 5 WD-40 repeats (PF00400) (1 weak); similar to Hypothetical RAE1-like protein.(SP:Q38942) [Arabidopsis thaliana]; similar to mRNA-associated protein mrnp 41 ((mRNA export protein) (GB:AAC28126) (GI:1903456)(RAE1) (MRNP41) (SP:P78406) [Homo sapiens] Length = 349 Score = 146 bits (355), Expect = 1e-35 Identities = 68/137 (49%), Positives = 93/137 (67%), Gaps = 2/137 (1%) Frame = -1 Query: 590 GFALGSVEGRVAIQYVNPTNPKDNFTFKCHRTTGAVGGYQDIYAVNDIAFHPVHGTLATV 411 GF +GS+EGRV + +++ + NFTFKCHR DIY+VN + FHPVHGT AT Sbjct: 211 GFLVGSIEGRVGVHHLDDSQQSKNFTFKCHRDGN------DIYSVNSLNFHPVHGTFATA 264 Query: 410 GSDGSFSFWDKDARTKLKSTELLDQSLTKCAFNHSGQIFAYAVGYDWSKGHEHYNP-NKK 234 GSDG+F+FWDKD++ +LK+ +Q + +FNH G I+AYA YDWSKG E++NP K Sbjct: 265 GSDGAFNFWDKDSKQRLKAMSRCNQPIPCSSFNHDGSIYAYAACYDWSKGAENHNPATAK 324 Query: 233 TFIYLRASYE-ELKARP 186 + I+L E E+KA+P Sbjct: 325 SSIFLHLPQESEVKAKP 341 Score = 54.4 bits (125), Expect = 8e-08 Identities = 24/57 (42%), Positives = 35/57 (61%) Frame = -3 Query: 777 LTXRAYXAXVEYPMAVVGTAXXGIXMXTLEGKPAEFKRIESPXKHQHRCVSIFQGQE 607 L + Y V++P+ VVGTA + + L+ EFKRI+SP K+Q RCV+ F Q+ Sbjct: 154 LPDKCYTLSVKHPLMVVGTADRNLIVFNLQNPQTEFKRIQSPLKYQTRCVTAFPDQQ 210 >At3g19590.1 68416.m02484 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP|O43684)[Homo sapiens] Length = 340 Score = 94.7 bits (225), Expect = 6e-20 Identities = 52/144 (36%), Positives = 81/144 (56%), Gaps = 3/144 (2%) Frame = -1 Query: 593 TGFALGSVEGRVAIQYVNPTNPKD--NFTFKCHRTTGAVGGYQDIYAVNDIAFHPVHGTL 420 TG+AL SVEGRVA+++ + + + FKCHR + A G +Y VN IAFHP++GT Sbjct: 199 TGYALSSVEGRVAMEFFDLSEAAQAKKYAFKCHRKSEA--GRDIVYPVNSIAFHPIYGTF 256 Query: 419 ATVGSDGSFSFWDKDARTKLKSTELLDQSLTKCAFNHSGQIFAYAVGYDWSKGHEHYNPN 240 AT G DG + WD + + +L S++ +F+ GQ+ A A Y + +G + P Sbjct: 257 ATGGCDGFVNIWDGNNKKRLYQYSKYPTSISALSFSRDGQLLAVASSYTFEEGEKSQEPE 316 Query: 239 KKTFIYLRASYE-ELKARPTQ*PH 171 I++R+ E E+K +P P+ Sbjct: 317 A---IFVRSVNEIEVKPKPKVYPN 337 >At1g49910.1 68414.m05597 WD-40 repeat family protein / mitotic checkpoint protein, putative contains 5 WD-40 repeats (PF00400) (1 weak); similar to testis mitotic checkpoint protein BUB3 (GB:AAC28439,SP:O43684)[Homo sapiens] Length = 339 Score = 86.6 bits (205), Expect = 2e-17 Identities = 48/144 (33%), Positives = 80/144 (55%), Gaps = 3/144 (2%) Frame = -1 Query: 593 TGFALGSVEGRVAIQYVNPTNPKD--NFTFKCHRTTGAVGGYQDIYAVNDIAFHPVHGTL 420 TG+AL SVEGRV++++ + + + FKCHR + G +Y VN IAFHP++GT Sbjct: 198 TGYALSSVEGRVSMEFFDLSEAAQAKKYAFKCHRKSE--DGRDIVYPVNAIAFHPIYGTF 255 Query: 419 ATVGSDGSFSFWDKDARTKLKSTELLDQSLTKCAFNHSGQIFAYAVGYDWSKGHEHYNPN 240 A+ G DG + WD + + +L S+ +F+ G + A A Y + +G + + P+ Sbjct: 256 ASGGCDGFVNIWDGNNKKRLYQYSKYPTSIAALSFSRDGGLLAVASSYTFEEGDKPHEPD 315 Query: 239 KKTFIYLRASYE-ELKARPTQ*PH 171 I++R+ E E+K +P P+ Sbjct: 316 A---IFVRSVNEIEVKPKPKVYPN 336 >At1g69400.1 68414.m07969 transducin family protein / WD-40 repeat family protein similar to mitotic checkpoint protein (GI:9294423) {Arabidopsis thaliana}; similar to mitotic checkpoint protein (BUB3) (SP:O43684) (Homo sapiens) Length = 314 Score = 62.9 bits (146), Expect = 2e-10 Identities = 34/114 (29%), Positives = 59/114 (51%), Gaps = 2/114 (1%) Frame = -1 Query: 590 GFALGSVEGRVAIQYVNPT-NPKDNFTFKCHRTTGAVGGYQDIYAVNDIAFHPV-HGTLA 417 G+A+GSV+GRVA+ + N + + + ++F+CH + G D +N I F P GT Sbjct: 191 GYAVGSVDGRVAVDFPNTSCSSEIKYSFRCHPKSR--NGRLDGVCINAIEFSPCGSGTFV 248 Query: 416 TVGSDGSFSFWDKDARTKLKSTELLDQSLTKCAFNHSGQIFAYAVGYDWSKGHE 255 T ++G W+ +R +L S+ AF+H+G++ A A + + E Sbjct: 249 TGDNEGYVISWNAKSRRRLNELPRYSNSIASLAFDHTGELLAIASSHTYQDAKE 302 >At1g69400.2 68414.m07968 transducin family protein / WD-40 repeat family protein similar to mitotic checkpoint protein (GI:9294423) {Arabidopsis thaliana}; similar to mitotic checkpoint protein (BUB3) (SP:O43684) (Homo sapiens) Length = 272 Score = 37.9 bits (84), Expect = 0.008 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = -1 Query: 590 GFALGSVEGRVAIQYVNPT-NPKDNFTFKCHRTTGAVGGYQDIYAVNDIAFHPVHGTL 420 G+A+GSV+GRVA+ + N + + + ++F+CH + G D +N I F P + +L Sbjct: 191 GYAVGSVDGRVAVDFPNTSCSSEIKYSFRCHPKSR--NGRLDGVCINAIEFSPWYMSL 246 >At3g16830.1 68416.m02149 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 32.3 bits (70), Expect = 0.38 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = -1 Query: 443 FHPVHGTLATVG-SDGSFSFWDKDARTKLKSTELLDQSLTKCAFNHSGQI 297 FHP H TL VG S G + W+ +R K+ + ++ C+ G I Sbjct: 355 FHPSHHTLLAVGCSSGEVTLWEVGSREKVVTEPFKIWNMAACSVIFQGSI 404 >At2g41500.1 68415.m05127 WD-40 repeat family protein / small nuclear ribonucleoprotein Prp4p-related similar to U4/U6 small nuclear ribonucleoprotein hPrp4 (GP:2708305) {Homo sapiens}; contains Pfam PF00400: WD domain, G-beta repeat (7 copies)|19877698|gb|AU238529.1|AU238529 Length = 554 Score = 31.9 bits (69), Expect = 0.50 Identities = 20/60 (33%), Positives = 29/60 (48%) Frame = -1 Query: 452 DIAFHPVHGTLATVGSDGSFSFWDKDARTKLKSTELLDQSLTKCAFNHSGQIFAYAVGYD 273 D+ F PV LAT +D + W D T L++ E L + AF+ SG+ + YD Sbjct: 303 DVVFSPVDDCLATASADRTAKLWKTDG-TLLQTFEGHLDRLARVAFHPSGK-YLGTTSYD 360 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = -1 Query: 449 IAFHPVHGTLATVGSDGSFSFWDKDARTKLKSTELLDQSLTKCAFNHSGQIFA 291 +AFHP L T D ++ WD + +L E +S+ AF G + A Sbjct: 345 VAFHPSGKYLGTTSYDKTWRLWDINTGAELLLQEGHSRSVYGIAFQQDGALAA 397 >At1g11160.1 68414.m01278 WD-40 repeat family protein / katanin p80 subunit, putative similar to contains 6 WD-40 repeats (PF00400); katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 974 Score = 31.5 bits (68), Expect = 0.66 Identities = 15/53 (28%), Positives = 25/53 (47%) Frame = -1 Query: 458 VNDIAFHPVHGTLATVGSDGSFSFWDKDARTKLKSTELLDQSLTKCAFNHSGQ 300 + + FHP+ LAT +D + FWD + + +T + AF+ GQ Sbjct: 136 IRSLDFHPLEFLLATGSADRTVKFWDLETFELIGTTRPEATGVRAIAFHPDGQ 188 >At5g27030.1 68418.m03224 WD-40 repeat family protein contains 8 WD-40 repeats (PF00400) (2 weak) Length = 1108 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -1 Query: 458 VNDIAFHPVHGTLATVGS-DGSFSFWDKDARTKLKSTELLDQSLTKCA 318 V + F+P+ TL VGS G + W+ AR +L S ++ C+ Sbjct: 348 VTSMEFYPMQNTLLLVGSATGEITLWELAARERLVSRPFKIWDMSNCS 395 >At4g29860.1 68417.m04250 transducin family protein / WD-40 repeat family protein contains 3 WD-40 repeats (PF00400); WDVCF variant 1 (gi:12006981) [Mus musculus] Length = 386 Score = 30.3 bits (65), Expect = 1.5 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 464 YAVNDIAFHPVHGTLATVGSDGSFSFWD 381 ++V D++FHP L T +DG WD Sbjct: 18 HSVMDVSFHPSKSLLFTGSADGELRIWD 45 >At2g31300.1 68415.m03821 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); identical to putative ARP2/3 protein complex subunit p41 (GI:4432825)[Arabidopsis thaliana]; similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:Q9WV32) [Mus musculus] Length = 378 Score = 30.3 bits (65), Expect = 1.5 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 1/82 (1%) Frame = -1 Query: 461 AVNDIAFHPVHGTLATVGSDGSFSFWDKDARTKLKSTELLDQSLTKCAFNHSG-QIFAYA 285 +V +A+HP + LAT +DG + T +K + D A G QI Sbjct: 147 SVTSVAWHPNNVLLATTSTDGKCRVFS----TFIKGVDTKDSKAGSPAETKFGEQILQLD 202 Query: 284 VGYDWSKGHEHYNPNKKTFIYL 219 + Y W+ G + ++P+ T Y+ Sbjct: 203 LSYSWAFGVK-WSPSGNTLAYV 223 >At2g30910.1 68415.m03767 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400) (1 weak); similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:O88656) [Rattus norvegicus] Length = 378 Score = 30.3 bits (65), Expect = 1.5 Identities = 22/82 (26%), Positives = 37/82 (45%), Gaps = 1/82 (1%) Frame = -1 Query: 461 AVNDIAFHPVHGTLATVGSDGSFSFWDKDARTKLKSTELLDQSLTKCAFNHSG-QIFAYA 285 +V +A+HP + LAT +DG + T +K + D A G QI Sbjct: 147 SVTSVAWHPNNVLLATTSTDGKCRVFS----TFIKGVDTKDSKAGSPAETKFGEQILQLD 202 Query: 284 VGYDWSKGHEHYNPNKKTFIYL 219 + Y W+ G + ++P+ T Y+ Sbjct: 203 LSYSWAFGVK-WSPSGNTLAYV 223 >At5g64630.2 68418.m08122 transducin family protein / WD-40 repeat family protein Similar to (SP:Q13112) Chromatin assembly factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo sapiens] Length = 487 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 476 YQDIYAVNDIAFHPVHGTLATVGSDGSFSFW 384 + D V + FHP+ G LAT G+D W Sbjct: 10 WHDGKPVLTVDFHPISGLLATAGADYDIKLW 40 >At5g64630.1 68418.m08121 transducin family protein / WD-40 repeat family protein Similar to (SP:Q13112) Chromatin assembly factor 1 subunit B (CAF-1 subunit B) (CAF-Ip60) [Homo sapiens] Length = 397 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -1 Query: 476 YQDIYAVNDIAFHPVHGTLATVGSDGSFSFW 384 + D V + FHP+ G LAT G+D W Sbjct: 10 WHDGKPVLTVDFHPISGLLATAGADYDIKLW 40 >At3g21060.1 68416.m02662 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to Retinoblastoma-binding protein 5 (RBBP-5) [Homo sapiens](RBQ-3) Length = 547 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -1 Query: 461 AVNDIAFHPVHGTLATVGSDGSFSFWDKD 375 A+ D+A+HPVH + +V G W KD Sbjct: 338 ALIDLAWHPVHPIIVSVSLAGLVYIWAKD 366 >At3g18140.1 68416.m02306 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); similar to Pop3 (GP:3434986) [Schizosaccharomyces pombe] Length = 305 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = -1 Query: 500 RTTGAVGGYQDIYAVNDIAFHPVHGTLATVGSDGSFSFWDKDART 366 R G Y+ + AVN + HP L + +G+ WD A + Sbjct: 108 RAPGCQKEYESVAAVNTVVLHPNQTELISGDQNGNIRVWDLRANS 152 >At1g61210.1 68414.m06897 WD-40 repeat family protein / katanin p80 subunit, putative contains 5 WD-40 repeats (PF00400); similar to katanin p80 subunit (GI:3005601) [Strongylocentrotus purpuratus] Length = 1180 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = -1 Query: 458 VNDIAFHPVHGTLATVGSDGSFSFWDKDARTKLKSTELLDQSLTKCAFNHSGQ 300 + + FHP+ LAT +D + FWD + + ST + F+ G+ Sbjct: 187 IRSLDFHPLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRSIKFHPDGR 239 >At2g37160.1 68415.m04559 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to Dystrophia myotonica-containing WD repeat motif protein DMR-N9 protein (DMWD) (DM9) (SP:Q08274) [Mus musculus]; simlar to DMR protein GI:18028289 [Homo sapiens]; Length = 544 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = -1 Query: 461 AVNDIAFHPVHGTLATVGSDGSFSFWDKDARTKLKSTELLDQSLTKCAFNHSGQ 300 A+N IAF LATVG DG +D + + + +L CA++ G+ Sbjct: 305 AINSIAFSNDGAYLATVGRDGYLRIFDFSTQKLVCGVKSYYGALLCCAWSMDGK 358 >At5g35960.1 68418.m04330 protein kinase, putative contains protein kinase domain, Pfam:PF00069 Length = 429 Score = 28.7 bits (61), Expect = 4.6 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = -1 Query: 497 TTGAVGGYQDIYAVNDIAFHPVHGTLATVGSDGSFSFWDKDARTKLKSTELLDQSL 330 T G V D++A+ + V G A S S W K K K EL+D SL Sbjct: 307 THGIVDEKTDVFALGVLLLELVTGRRALDYSKQSLVLWAKPLMKKNKIRELIDPSL 362 >At2g30910.2 68415.m03768 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400) (1 weak); similar to ARP2/3 complex 41 kDa subunit (P41-ARC) (Actin-related protein 2/3 complex subunit 1B) (SP:O88656) [Rattus norvegicus] Length = 378 Score = 28.3 bits (60), Expect = 6.1 Identities = 24/84 (28%), Positives = 37/84 (44%), Gaps = 3/84 (3%) Frame = -1 Query: 461 AVNDIAFHPVHGTLATVGSDGS---FSFWDKDARTKLKSTELLDQSLTKCAFNHSGQIFA 291 +V +A+HP + LAT +DG FS + K TK L F QI Sbjct: 147 SVTSVAWHPNNVLLATTSTDGKCRVFSTFIKGVDTKYA------HYLNGAFFLLKQQILQ 200 Query: 290 YAVGYDWSKGHEHYNPNKKTFIYL 219 + Y W+ G + ++P+ T Y+ Sbjct: 201 LDLSYSWAFGVK-WSPSGNTLAYV 223 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,930,638 Number of Sequences: 28952 Number of extensions: 235607 Number of successful extensions: 821 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 744 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 816 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1765546400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -