BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_A17 (795 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25605.1 68415.m03067 expressed protein 31 1.2 At4g01030.1 68417.m00140 pentatricopeptide (PPR) repeat-containi... 30 2.0 At5g14600.1 68418.m01712 expressed protein 29 3.6 At4g17500.1 68417.m02618 ethylene-responsive element-binding pro... 29 4.7 At5g10800.1 68418.m01255 RNA recognition motif (RRM)-containing ... 28 8.2 At3g12690.3 68416.m01586 protein kinase, putative similar to vir... 28 8.2 At3g12690.2 68416.m01585 protein kinase, putative similar to vir... 28 8.2 At3g12690.1 68416.m01584 protein kinase, putative similar to vir... 28 8.2 At2g45160.1 68415.m05622 scarecrow transcription factor family p... 28 8.2 At1g11760.1 68414.m01349 expressed protein weak similarity to Pf... 28 8.2 >At2g25605.1 68415.m03067 expressed protein Length = 200 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 2/41 (4%) Frame = -2 Query: 449 SASMRHFDKAARHEDPLIVAAGNYIPD--PADRMESSRRRP 333 SA+++HF+ R L+ A+ + +PD AD +ES R+RP Sbjct: 16 SANVKHFNGYGRLNRNLVRASSSDVPDFLSADWLESRRKRP 56 >At4g01030.1 68417.m00140 pentatricopeptide (PPR) repeat-containing protein contains INTERPRO:IPR002885 PPR repeats Length = 500 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/36 (38%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = +2 Query: 173 LRRSGEKLSGLCLRVNLLVEPFVAS---DGFDENGD 271 L SG+++ G CLR NL+ + +VA+ D + ++GD Sbjct: 143 LLHSGKEVHGFCLRKNLICDAYVATALVDMYGKSGD 178 >At5g14600.1 68418.m01712 expressed protein Length = 318 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -3 Query: 457 ICSRRPCATSIKRHDTRTLSSWPPVTTFPILRTEWKAVDVALNTSSRI 314 +CS PC ++R S + + TF +L ++ +V ++TSS + Sbjct: 209 LCSFSPCIEQVQRTCEVLRSDFIEIRTFEVLLRTYEVKEVKMDTSSMV 256 >At4g17500.1 68417.m02618 ethylene-responsive element-binding protein 1 (ERF1) / EREBP-2 protein identical to SP|O80337 Ethylene responsive element binding factor 1 (EREBP-2 protein) [Arabidopsis thaliana]; a false single bp exon was added to circumvent a single basepair insertion in the genomic sequence, supported by cDNA/genome alignment. Length = 188 Score = 28.7 bits (61), Expect = 4.7 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 387 GGHDERVLVSCRFIEVAHGRRLQIL 461 GG D+ + V C +EVA G RL +L Sbjct: 164 GGMDKGLTVKCEVVEVARGDRLLVL 188 >At5g10800.1 68418.m01255 RNA recognition motif (RRM)-containing protein KIAA0332 gene, Homo sapiens, EMBL:HSAB2330 Length = 947 Score = 27.9 bits (59), Expect = 8.2 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -3 Query: 211 QTQPTEFLAGSSQWVAFPXPVVDSAKH 131 +T+P +AGS +W+ P P S +H Sbjct: 396 RTEPYIMIAGSGRWIPPPLPATRSPEH 422 >At3g12690.3 68416.m01586 protein kinase, putative similar to viroid symptom modulation protein [Lycopersicon esculentum] gi|7672777|gb|AAF66637 Length = 577 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -1 Query: 279 KHRSPFSSNPSLATKGSTSKLTLRHSPLSFSPDLLS 172 KH+ P S P +T+G+ S+ L+H+ S D L+ Sbjct: 56 KHQPPKSLEPPPSTRGTNSEGDLKHNTYSSDGDSLA 91 >At3g12690.2 68416.m01585 protein kinase, putative similar to viroid symptom modulation protein [Lycopersicon esculentum] gi|7672777|gb|AAF66637 Length = 577 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -1 Query: 279 KHRSPFSSNPSLATKGSTSKLTLRHSPLSFSPDLLS 172 KH+ P S P +T+G+ S+ L+H+ S D L+ Sbjct: 56 KHQPPKSLEPPPSTRGTNSEGDLKHNTYSSDGDSLA 91 >At3g12690.1 68416.m01584 protein kinase, putative similar to viroid symptom modulation protein [Lycopersicon esculentum] gi|7672777|gb|AAF66637 Length = 577 Score = 27.9 bits (59), Expect = 8.2 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -1 Query: 279 KHRSPFSSNPSLATKGSTSKLTLRHSPLSFSPDLLS 172 KH+ P S P +T+G+ S+ L+H+ S D L+ Sbjct: 56 KHQPPKSLEPPPSTRGTNSEGDLKHNTYSSDGDSLA 91 >At2g45160.1 68415.m05622 scarecrow transcription factor family protein Length = 640 Score = 27.9 bits (59), Expect = 8.2 Identities = 16/44 (36%), Positives = 20/44 (45%) Frame = -3 Query: 748 PHIKTVRDPCRLHFRTSXPR*YVGEVKCPLEIR*HSTKLAYAPS 617 P TV D L F + + GEVK P EI S +L P+ Sbjct: 425 PPPSTVSDEFELRFTEENLKTFAGEVKIPFEIELLSVELLLNPA 468 >At1g11760.1 68414.m01349 expressed protein weak similarity to Pfam PF01648: 4'-phosphopantetheinyl transferase superfamily Length = 393 Score = 27.9 bits (59), Expect = 8.2 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = +1 Query: 67 LVGELTGLKPDDVANTNPSK-SRASQNLPPXSETRPTEKIRRETQWAVSE 213 LV E TGL P+ + A+ +LPP S R E++ R +W V E Sbjct: 96 LVDEATGLTTTAAGGQAPAAVTGAATSLPPISAVR-LEQMSRAVRWLVLE 144 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,051,624 Number of Sequences: 28952 Number of extensions: 305148 Number of successful extensions: 990 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 908 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 990 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1794809600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -