BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_A16 (818 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47163| Best HMM Match : SH2 (HMM E-Value=6.4) 42 8e-04 SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18) 41 0.001 SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) 41 0.001 SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) 41 0.001 SB_29609| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_25444| Best HMM Match : SH2 (HMM E-Value=6.4) 40 0.002 SB_9149| Best HMM Match : Lipase_GDSL (HMM E-Value=0.51) 38 0.007 SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.010 SB_16338| Best HMM Match : PHD (HMM E-Value=3.8e-08) 38 0.010 SB_9316| Best HMM Match : SH2 (HMM E-Value=6.4) 37 0.023 SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) 37 0.023 SB_58983| Best HMM Match : Integrin_alpha (HMM E-Value=2.7) 37 0.023 SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.023 SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.039 SB_31424| Best HMM Match : Sigma54_activat (HMM E-Value=6.2) 36 0.052 SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) 36 0.052 SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.069 SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 35 0.069 SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.069 SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 35 0.069 SB_25871| Best HMM Match : SLH (HMM E-Value=1.1) 35 0.069 SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) 35 0.069 SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) 35 0.069 SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) 35 0.069 SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) 35 0.069 SB_56531| Best HMM Match : SLH (HMM E-Value=1.1) 35 0.069 SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) 35 0.069 SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 35 0.069 SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.069 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 35 0.069 SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) 35 0.069 SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) 35 0.069 SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) 35 0.069 SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.069 SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) 35 0.069 SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.069 SB_356| Best HMM Match : zf-C3HC4 (HMM E-Value=0.06) 35 0.069 SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) 35 0.091 SB_35765| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_59287| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.091 SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) 34 0.12 SB_11072| Best HMM Match : SH2 (HMM E-Value=6.4) 34 0.12 SB_4872| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_4770| Best HMM Match : Exo_endo_phos (HMM E-Value=0.031) 34 0.12 SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_10126| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) 34 0.12 SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) 34 0.16 SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.16 SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) 34 0.16 SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 SB_39284| Best HMM Match : WW (HMM E-Value=7.9) 34 0.16 SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) 34 0.16 SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) 33 0.21 SB_23375| Best HMM Match : PCI (HMM E-Value=9.5) 33 0.21 SB_54439| Best HMM Match : SNF (HMM E-Value=0) 33 0.21 SB_37723| Best HMM Match : RVT_1 (HMM E-Value=0.054) 33 0.21 SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_53921| Best HMM Match : Viral_P18 (HMM E-Value=2.6) 33 0.28 SB_52416| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_36270| Best HMM Match : Viral_P18 (HMM E-Value=4.9) 33 0.28 SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) 33 0.28 SB_29973| Best HMM Match : RVT_1 (HMM E-Value=5.2e-21) 33 0.28 SB_23846| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_23599| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_9383| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) 33 0.28 SB_8006| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_5462| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_55213| Best HMM Match : Viral_P18 (HMM E-Value=2.6) 33 0.28 SB_53437| Best HMM Match : DUF1126 (HMM E-Value=5.1) 33 0.28 SB_52244| Best HMM Match : RVT_1 (HMM E-Value=9.5e-20) 33 0.28 SB_51865| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_43560| Best HMM Match : DUF633 (HMM E-Value=4.4) 33 0.28 SB_33864| Best HMM Match : WD40 (HMM E-Value=2.1) 33 0.28 SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) 33 0.28 SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) 33 0.28 SB_18416| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.28 SB_35414| Best HMM Match : NinE (HMM E-Value=8.4) 33 0.37 SB_13193| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1) 33 0.37 SB_40765| Best HMM Match : DX (HMM E-Value=1.4) 33 0.37 SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.37 SB_38574| Best HMM Match : WW (HMM E-Value=4.9) 33 0.37 SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 33 0.37 SB_4548| Best HMM Match : WD40 (HMM E-Value=6.7e-35) 33 0.37 SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) 33 0.37 SB_59170| Best HMM Match : RVT_1 (HMM E-Value=0.13) 32 0.49 SB_57709| Best HMM Match : RVT_1 (HMM E-Value=0.00081) 32 0.49 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.49 SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) 32 0.49 SB_30875| Best HMM Match : Rubredoxin (HMM E-Value=1.6) 32 0.49 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 32 0.49 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 32 0.49 SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_5514| Best HMM Match : TB (HMM E-Value=4.3) 32 0.49 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 32 0.49 SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.49 SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) 32 0.49 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.49 SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.49 SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) 32 0.49 SB_15890| Best HMM Match : ArsC (HMM E-Value=0.94) 32 0.49 SB_20315| Best HMM Match : RVT_1 (HMM E-Value=1.4e-21) 32 0.64 SB_7179| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_7040| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_35861| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_19895| Best HMM Match : PHD (HMM E-Value=3.8e-08) 32 0.64 SB_4311| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.64 SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_24320| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.85 SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) 31 0.85 SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14) 31 0.85 SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) 31 0.85 SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) 31 1.1 SB_27289| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_12986| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_7633| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_51996| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_43796| Best HMM Match : SH2 (HMM E-Value=6.4) 31 1.1 SB_41403| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_6674| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) 31 1.1 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_43127| Best HMM Match : DUF1690 (HMM E-Value=2.2) 31 1.5 SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 31 1.5 SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) 31 1.5 SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) 31 1.5 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) 31 1.5 SB_51096| Best HMM Match : Baculo_ME53 (HMM E-Value=5.6) 31 1.5 SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) 31 1.5 SB_18362| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 31 1.5 SB_9954| Best HMM Match : SLH (HMM E-Value=1.1) 31 1.5 SB_8726| Best HMM Match : Pox_F16 (HMM E-Value=5.2) 31 1.5 SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) 30 2.0 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_44720| Best HMM Match : Helicase_C (HMM E-Value=0.59) 30 2.0 SB_38681| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 30 2.0 SB_24260| Best HMM Match : Rotavirus_VP7 (HMM E-Value=7.7) 30 2.0 SB_18090| Best HMM Match : RVT_1 (HMM E-Value=0.59) 30 2.0 SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 30 2.0 SB_17216| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_16275| Best HMM Match : RVT_1 (HMM E-Value=1.7e-16) 30 2.0 SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_52890| Best HMM Match : PH (HMM E-Value=1e-06) 30 2.6 SB_49650| Best HMM Match : RVT_1 (HMM E-Value=1.3) 30 2.6 SB_16546| Best HMM Match : SH2 (HMM E-Value=6.4) 30 2.6 SB_5302| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_270| Best HMM Match : PHD (HMM E-Value=0.0037) 30 2.6 SB_58494| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) 30 2.6 SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) 30 2.6 SB_45899| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) 30 2.6 SB_33068| Best HMM Match : Galactosyl_T (HMM E-Value=5.9e-37) 30 2.6 SB_8964| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_59555| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 29 3.4 SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) 29 3.4 SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_39979| Best HMM Match : RVT_1 (HMM E-Value=4.6e-12) 29 3.4 SB_38350| Best HMM Match : OCIA (HMM E-Value=6.7) 29 3.4 SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) 29 3.4 SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) 29 3.4 SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_21287| Best HMM Match : Lectin_C (HMM E-Value=3.1) 29 3.4 SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) 29 3.4 SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) 29 3.4 SB_8874| Best HMM Match : PhaG_MnhG_YufB (HMM E-Value=2.4) 29 3.4 SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 29 3.4 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 29 3.4 SB_43623| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) 29 3.4 SB_46063| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00015) 29 4.5 SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) 29 4.5 SB_29434| Best HMM Match : Peptidase_A17 (HMM E-Value=3.1e-25) 29 4.5 SB_54846| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) 29 4.5 SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) 29 4.5 SB_36728| Best HMM Match : ArsD (HMM E-Value=1.6) 29 6.0 SB_36411| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_6579| Best HMM Match : RVT_1 (HMM E-Value=2.5e-14) 29 6.0 SB_59269| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_53402| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.0 SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) 29 6.0 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 29 6.0 SB_39569| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_36917| Best HMM Match : RinB (HMM E-Value=2.2) 28 7.9 SB_48079| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_47163| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 172 Score = 41.5 bits (93), Expect = 8e-04 Identities = 23/100 (23%), Positives = 46/100 (46%), Gaps = 2/100 (2%) Frame = -3 Query: 687 LCSRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPW 514 L R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 72 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 131 Query: 513 FLRNVDLHDDLELDSFSKYLQSASLRHFEKAARHENPLIV 394 + L ++L + F K + L KA + P + Sbjct: 132 DAPSKPLFEELNIVPFDKRITYLQLVLLFKAMNNMTPCYI 171 >SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18) Length = 552 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/100 (23%), Positives = 46/100 (46%), Gaps = 2/100 (2%) Frame = -3 Query: 687 LCSRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPW 514 L R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 409 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 468 Query: 513 FLRNVDLHDDLELDSFSKYLQSASLRHFEKAARHENPLIV 394 + L ++L + F K + L KA + P + Sbjct: 469 DAPSKPLFEELNIVPFDKRIIYLQLVLLFKAMNNMTPCYI 508 >SB_7414| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 323 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/100 (23%), Positives = 46/100 (46%), Gaps = 2/100 (2%) Frame = -3 Query: 687 LCSRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPW 514 L R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 186 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 245 Query: 513 FLRNVDLHDDLELDSFSKYLQSASLRHFEKAARHENPLIV 394 + L ++L + F K + L KA + P + Sbjct: 246 DSPSKPLFEELNIVPFDKRIIYLQLVLLFKAMNNMTPFYI 285 >SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) Length = 309 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/100 (23%), Positives = 46/100 (46%), Gaps = 2/100 (2%) Frame = -3 Query: 687 LCSRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPW 514 L R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 207 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 266 Query: 513 FLRNVDLHDDLELDSFSKYLQSASLRHFEKAARHENPLIV 394 + L ++L + F K + L KA + P + Sbjct: 267 DAPSKPLFEELNIVPFDKRIIYLQLVLLFKAMNNMTPCYI 306 >SB_29609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 40.3 bits (90), Expect = 0.002 Identities = 20/92 (21%), Positives = 42/92 (45%) Frame = -3 Query: 669 LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPWFLRNVDLH 490 LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ + W + L Sbjct: 70 LSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKWDAPSKPLF 129 Query: 489 DDLELDSFSKYLQSASLRHFEKAARHENPLIV 394 ++L + F K + L KA + P + Sbjct: 130 EELNIVPFDKRIIYLQLVLLFKAMNNMTPCYI 161 >SB_25444| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 252 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/100 (23%), Positives = 46/100 (46%), Gaps = 2/100 (2%) Frame = -3 Query: 687 LCSRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPW 514 L R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 109 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 168 Query: 513 FLRNVDLHDDLELDSFSKYLQSASLRHFEKAARHENPLIV 394 + L ++L + F K + L KA + P + Sbjct: 169 DAPSKPLFEELNIVPFDKGIIYLQLVLLFKAMNNMTPCYI 208 >SB_9149| Best HMM Match : Lipase_GDSL (HMM E-Value=0.51) Length = 604 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/97 (22%), Positives = 44/97 (45%), Gaps = 2/97 (2%) Frame = -3 Query: 687 LCSRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPW 514 L R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q + R+ + W Sbjct: 436 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKQCARVIIDKKW 495 Query: 513 FLRNVDLHDDLELDSFSKYLQSASLRHFEKAARHENP 403 L ++L + F K + L KA + P Sbjct: 496 DAPAKPLFEELNIVPFDKRIIYLQLVLLLKAMNNMTP 532 >SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 37.9 bits (84), Expect = 0.010 Identities = 22/100 (22%), Positives = 46/100 (46%), Gaps = 2/100 (2%) Frame = -3 Query: 687 LCSRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPW 514 L R+K LSL+ + Y + I+P++ Y ++V+ + ++ + + R R+ + W Sbjct: 204 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGLTKKQHIDYMVKFEKRCARVILDKKW 263 Query: 513 FLRNVDLHDDLELDSFSKYLQSASLRHFEKAARHENPLIV 394 + L ++L + F K + L KA + P + Sbjct: 264 DAPSKPLFEELNIVPFDKRIIYLQLVLLFKAMNNMTPCYI 303 >SB_16338| Best HMM Match : PHD (HMM E-Value=3.8e-08) Length = 652 Score = 37.9 bits (84), Expect = 0.010 Identities = 32/95 (33%), Positives = 50/95 (52%), Gaps = 2/95 (2%) Frame = -3 Query: 699 LYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR-IAVG 523 L P+L S+S LSLR + +Y +C+R M YA +A + ++L LQ + R I V Sbjct: 549 LLPVLSSKS-LSLRTRGKVYSSCVRSAMLYAGECWAPKS-SDLARLQRSEHAMLRWICVL 606 Query: 522 APWFLRNVD-LHDDLELDSFSKYLQSASLRHFEKA 421 P ++ + D L ++S L+ A LR F +A Sbjct: 607 KPEDDTSLSTIRDRLGIESLELALRKARLRWFGQA 641 >SB_9316| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 169 Score = 36.7 bits (81), Expect = 0.023 Identities = 22/97 (22%), Positives = 44/97 (45%), Gaps = 2/97 (2%) Frame = -3 Query: 687 LCSRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPW 514 L R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R+ + W Sbjct: 72 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKGCARVILDKKW 131 Query: 513 FLRNVDLHDDLELDSFSKYLQSASLRHFEKAARHENP 403 + L ++L + F K + L KA + P Sbjct: 132 NAPSKPLLEELNIVPFDKRIIYLQLVLLFKAMNNMTP 168 >SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) Length = 294 Score = 36.7 bits (81), Expect = 0.023 Identities = 38/129 (29%), Positives = 56/129 (43%), Gaps = 4/129 (3%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG----APWFLRNVDLHD 487 K YK+ + P + YAS + + ++K ++ +Q R R P + N+ + Sbjct: 142 KEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVQRRAGRFVTNCWDRTPGTVTNI--LN 199 Query: 486 DLELDSFSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRRPKHVITDPPD 307 DLE SK Q+A L F KA ++ L IPD +DR R+ R H PD Sbjct: 200 DLEWPPLSKRRQNARLTLFYKAVNKKSAL------EIPDNIDRR-TRQLRSSH-----PD 247 Query: 306 PLTVLLGTT 280 L TT Sbjct: 248 KFIELCPTT 256 >SB_58983| Best HMM Match : Integrin_alpha (HMM E-Value=2.7) Length = 237 Score = 36.7 bits (81), Expect = 0.023 Identities = 34/113 (30%), Positives = 50/113 (44%), Gaps = 4/113 (3%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG----APWFLRNVDLHD 487 K YKT + P + YAS + + ++K ++ +Q R R P + N+ + Sbjct: 115 KEAAYKTLVLPHLEYASSAWDPWLKKHVKQIEKVQRRAGRFVKNCWDRTPGTVTNI--LN 172 Query: 486 DLELDSFSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRRPKH 328 DLE SK Q A L F KA ++ L IPD +DR R+ R H Sbjct: 173 DLEWPPLSKRRQDARLTLFYKAVNKKSAL------EIPDNIDRR-TRQLRSSH 218 >SB_23320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1136 Score = 36.7 bits (81), Expect = 0.023 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = -3 Query: 690 MLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLK-SLQVIQSRFCRIA 529 +L R+++ + + + Y TC+RP++ Y + +F H +K L+ IQ R IA Sbjct: 625 VLLKRARVPVSDIIGFYNTCVRPILEYCAPLFHHTIPAYVKEDLEHIQKRALSIA 679 >SB_16447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 35.9 bits (79), Expect = 0.039 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -3 Query: 702 RLYPML-CSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 RLY + R +S + V +Y + IR V+ YASVVFA+ + SL+ IQ R RI Sbjct: 690 RLYALRQLKRCGVSPVDIVLVYCSLIRSVIEYASVVFANLPQYLANSLEAIQKRALRI 747 >SB_31424| Best HMM Match : Sigma54_activat (HMM E-Value=6.2) Length = 263 Score = 35.5 bits (78), Expect = 0.052 Identities = 33/114 (28%), Positives = 51/114 (44%), Gaps = 4/114 (3%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG----APWFLRNVDLHD 487 K YK+ + P + YAS + + ++K ++ +Q R R P + N+ + Sbjct: 135 KEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVQRRAGRFVKNCWDRTPGTVTNI--LN 192 Query: 486 DLELDSFSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRRPKHV 325 DLE SK Q A L F KA ++ L IPD +DR R+ R H+ Sbjct: 193 DLEWPPLSKRRQDARLTLFYKAVNKKSAL------EIPDNIDRR-TRQLRSSHL 239 >SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) Length = 698 Score = 35.5 bits (78), Expect = 0.052 Identities = 31/109 (28%), Positives = 48/109 (44%), Gaps = 4/109 (3%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG----APWFLRNVDLHD 487 K YK+ + P + YAS + + ++K ++ +Q R R P + N+ + Sbjct: 548 KEAAYKSLVHPHLEYASSAWDPWLKKHVKQIEKVQRRAGRFVKNCWDRTPGTVTNI--LN 605 Query: 486 DLELDSFSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRR 340 DLE SK Q A L F KA ++ L IPD +DR + R Sbjct: 606 DLEWPPLSKRRQDARLTLFYKAVNKKSAL------KIPDNIDRRTRQLR 648 >SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1402 Score = 35.1 bits (77), Expect = 0.069 Identities = 33/113 (29%), Positives = 50/113 (44%), Gaps = 4/113 (3%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG----APWFLRNVDLHD 487 K YK+ + P + YAS + + ++K ++ +Q R R P + N+ + Sbjct: 813 KEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVQRRSGRFVKNCWDRTPGTVTNI--LN 870 Query: 486 DLELDSFSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRRPKH 328 DLE SK Q A L F KA ++ L IPD +DR R+ R H Sbjct: 871 DLEWPPLSKRRQDARLTLFYKAVNKKSAL------KIPDNIDRR-TRQLRSSH 916 >SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 226 Score = 35.1 bits (77), Expect = 0.069 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 Query: 522 APWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 W + N ++ + L + L+ LR R EN Sbjct: 62 IHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 102 >SB_41028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 798 Score = 35.1 bits (77), Expect = 0.069 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 553 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 611 Query: 522 APWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 W + N ++ + L + L+ LR R EN Sbjct: 612 IHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 652 >SB_35827| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 223 Score = 35.1 bits (77), Expect = 0.069 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 Query: 522 APWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 W + N ++ + L + L+ LR R EN Sbjct: 62 IHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 102 >SB_25871| Best HMM Match : SLH (HMM E-Value=1.1) Length = 172 Score = 35.1 bits (77), Expect = 0.069 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -3 Query: 702 RLYPML-CSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 544 RLY + R +S N + +Y++ +R + YASVVFA R SL+ +Q R Sbjct: 7 RLYAIRQLKRCGVSTDNIIVVYRSLVRSTLEYASVVFADLPRYLSDSLERVQKR 60 >SB_14018| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 35.1 bits (77), Expect = 0.069 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 84 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 142 Query: 522 APWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 W + N ++ + L + L+ LR R EN Sbjct: 143 IHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 183 >SB_6495| Best HMM Match : RVT_1 (HMM E-Value=1.2e-17) Length = 554 Score = 35.1 bits (77), Expect = 0.069 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -3 Query: 702 RLYPML-CSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 544 RLY + R +S N + +Y++ +R + YASVVFA R SL+ +Q R Sbjct: 389 RLYAIRQLKRCGVSTDNIIVVYRSLVRSTLEYASVVFADLPRYLSDSLERVQKR 442 >SB_3826| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 238 Score = 35.1 bits (77), Expect = 0.069 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 84 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLHTFHMRCLRRILG 142 Query: 522 APWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 W + N ++ + L + L+ LR R EN Sbjct: 143 IHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 183 >SB_57860| Best HMM Match : DUF1226 (HMM E-Value=1.5e-07) Length = 754 Score = 35.1 bits (77), Expect = 0.069 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 Query: 522 APWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 W + N ++ + L + L+ LR R EN Sbjct: 62 IHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 102 >SB_56531| Best HMM Match : SLH (HMM E-Value=1.1) Length = 151 Score = 35.1 bits (77), Expect = 0.069 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = -3 Query: 702 RLYPML-CSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 544 RLY + R +S N + +Y++ +R + YASVVFA R SL+ +Q R Sbjct: 7 RLYAIRQLKRCGVSTDNIIVVYRSLVRSTLKYASVVFADLPRYLSDSLERVQKR 60 >SB_53622| Best HMM Match : RVT_1 (HMM E-Value=7.90332e-43) Length = 458 Score = 35.1 bits (77), Expect = 0.069 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 304 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 362 Query: 522 APWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 W + N ++ + L + L+ LR R EN Sbjct: 363 IHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 403 >SB_49894| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 226 Score = 35.1 bits (77), Expect = 0.069 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 Query: 522 APWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 W + N ++ + L + L+ LR R EN Sbjct: 62 IHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 102 >SB_45372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2973 Score = 35.1 bits (77), Expect = 0.069 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 2395 KLSSRVWENKKLTISTKITVYRACILSTLLYGSEPWTTYARQE-KRLNTFHMRCLRRILG 2453 Query: 522 APWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 W + N ++ + L + L+ LR R EN Sbjct: 2454 IHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 2494 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 35.1 bits (77), Expect = 0.069 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 84 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLHTFHMRCLRRILG 142 Query: 522 APWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 W + N ++ + L + L+ LR R EN Sbjct: 143 IHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 183 >SB_42164| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 290 Score = 35.1 bits (77), Expect = 0.069 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 136 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 194 Query: 522 APWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 W + N ++ + L + L+ LR R EN Sbjct: 195 IHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 235 >SB_34465| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 280 Score = 35.1 bits (77), Expect = 0.069 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 84 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 142 Query: 522 APWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 W + N ++ + L + L+ LR R EN Sbjct: 143 IHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 183 >SB_30624| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 406 Score = 35.1 bits (77), Expect = 0.069 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 Query: 522 APWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 W + N ++ + L + L+ LR R EN Sbjct: 62 IHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 102 >SB_27308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 35.1 bits (77), Expect = 0.069 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 119 KLSSRVWENKKLTISTKITVYRACILSTLLYGSKSWTTYARQE-KRLNTFHMRCLRRILG 177 Query: 522 APWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 W + N ++ + L + L+ LR R EN Sbjct: 178 IHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 218 >SB_17490| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 348 Score = 35.1 bits (77), Expect = 0.069 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 136 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 194 Query: 522 APWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 W + N ++ + L + L+ LR R EN Sbjct: 195 IHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 235 >SB_2346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 35.1 bits (77), Expect = 0.069 Identities = 26/101 (25%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 Query: 522 APWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 W + N ++ + L + L+ LR R EN Sbjct: 62 IHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 102 >SB_356| Best HMM Match : zf-C3HC4 (HMM E-Value=0.06) Length = 587 Score = 35.1 bits (77), Expect = 0.069 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 529 RLY + + + L + +T+Y++ IR V+ YAS FA+ +L+ +Q R +IA Sbjct: 66 RLYALRVLKKCGLDAKELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 124 >SB_41884| Best HMM Match : RVT_1 (HMM E-Value=1.69557e-43) Length = 677 Score = 34.7 bits (76), Expect = 0.091 Identities = 25/101 (24%), Positives = 42/101 (41%), Gaps = 2/101 (1%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ C+ + Y S + AR K L R R +G Sbjct: 475 KLSSRVWENKKLTISTKITVYRACVLSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 533 Query: 522 APWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 W + N ++ + L + L+ LR R EN Sbjct: 534 IHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 574 >SB_35765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 34.7 bits (76), Expect = 0.091 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 529 RLY + + + L +T+Y++ IR V+ YAS VFA+ +L+ +Q R +IA Sbjct: 44 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAVFANLPNYLSDALENVQRRALKIA 102 >SB_59287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 34.7 bits (76), Expect = 0.091 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 529 RLY + + + L +T+Y++ IR V+ YAS VFA+ +L+ +Q R +IA Sbjct: 44 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAVFANLPNYLSDALENVQRRALKIA 102 >SB_37379| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 342 Score = 34.7 bits (76), Expect = 0.091 Identities = 25/91 (27%), Positives = 39/91 (42%), Gaps = 2/91 (2%) Frame = -3 Query: 672 KLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPWF--LRNV 499 KL++ K+T+Y+ CI + Y S + AR K L R R +G W + N Sbjct: 129 KLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHWSDKVTNN 187 Query: 498 DLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 ++ + L + L+ LR R EN Sbjct: 188 EVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 218 >SB_12192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 34.7 bits (76), Expect = 0.091 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -3 Query: 678 RSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKS-LQVIQSRFCRI 532 R+ + ++ + Y TCIRPV YA VF H L + L+ Q R RI Sbjct: 1214 RANIKVKELLLFYLTCIRPVTEYACPVFHHCLPQYLSNDLERCQKRALRI 1263 >SB_34904| Best HMM Match : RVT_1 (HMM E-Value=1.1e-06) Length = 530 Score = 34.3 bits (75), Expect = 0.12 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 3/102 (2%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR-FCRIAV 526 +L + KL++ K+T+Y+ CI + Y S + AR K L R CRI + Sbjct: 307 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLCRI-L 364 Query: 525 GAPWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 G W + N ++ + L + L+ LR R EN Sbjct: 365 GIHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 406 >SB_11072| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 228 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = -3 Query: 687 LCSRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPW 514 L R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 160 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 219 >SB_4872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 403 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = -3 Query: 678 RSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNL-KSLQVIQSRFCRI 532 RS L+ V+ ++TC+RP+ YA V+ + + L SL+ +Q R RI Sbjct: 277 RSGLAKSGLVSFFRTCVRPITEYACPVYHDSLPSYLSNSLEQVQRRALRI 326 >SB_4770| Best HMM Match : Exo_endo_phos (HMM E-Value=0.031) Length = 599 Score = 34.3 bits (75), Expect = 0.12 Identities = 19/54 (35%), Positives = 30/54 (55%) Frame = -3 Query: 678 RSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAP 517 R +S N + +Y++ +R + YASVVFA R SL+ +Q C +A+ P Sbjct: 464 RCGVSTDNIIVVYRSLVRSTLEYASVVFADLPRYLSDSLERVQK--CTLAIIYP 515 >SB_4450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 410 Score = 34.3 bits (75), Expect = 0.12 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 3/102 (2%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR-FCRIAV 526 +L + KL++ K+T+Y+ CI + Y S + AR K L R CRI + Sbjct: 187 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLCRI-L 244 Query: 525 GAPWF--LRNVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 G W + N ++ + L + L+ LR R EN Sbjct: 245 GIHWSDKVTNNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 286 >SB_10126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 523 Score = 34.3 bits (75), Expect = 0.12 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = -3 Query: 702 RLYPML-CSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNL-KSLQVIQSRFCRI 532 RLY + R+ L Y TCIRP+M YA VF ++ L + L++I+ R RI Sbjct: 323 RLYCLRQLKRASLGSEELHQFYLTCIRPIMEYACPVFHNSLPDYLSQDLEIIRRRALRI 381 >SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) Length = 675 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = -3 Query: 687 LCSRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPW 514 L R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 605 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 664 >SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1462 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/39 (35%), Positives = 27/39 (69%) Frame = -3 Query: 648 TLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 +LY + +RP + YAS V+A A T+++S++ +Q R ++ Sbjct: 858 SLYLSIVRPTVGYASEVWAPQAITDMRSVEALQRRATKV 896 >SB_22184| Best HMM Match : PHD (HMM E-Value=0.00011) Length = 634 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = -3 Query: 699 LYPMLCSRSKLSLRNKVTLYKTCIRPVMTYAS 604 L P+LCS+S LSL + +Y +C+R + YAS Sbjct: 474 LLPILCSKS-LSLHTRGRIYSSCVRGALLYAS 504 >SB_12945| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/65 (27%), Positives = 29/65 (44%) Frame = -3 Query: 708 LGRLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 529 + +L + KL++ K+T+Y+ CI + Y S + AR K L R R Sbjct: 81 MSKLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRI 139 Query: 528 VGAPW 514 +G W Sbjct: 140 LGIHW 144 >SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 943 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/39 (35%), Positives = 27/39 (69%) Frame = -3 Query: 648 TLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 +LY + +RP + YAS V+A A T+++S++ +Q R ++ Sbjct: 449 SLYLSIVRPTVGYASEVWAPQAITDMRSVEALQRRATKV 487 >SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) Length = 277 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/60 (25%), Positives = 30/60 (50%), Gaps = 2/60 (3%) Frame = -3 Query: 687 LCSRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPW 514 L R+K LSL+ + Y I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 207 LLKRTKKFLSLKARTLFYHALIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDKKW 266 >SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 893 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/60 (25%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = -3 Query: 687 LCSRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPW 514 L R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ + W Sbjct: 823 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARVILDNKW 882 >SB_39284| Best HMM Match : WW (HMM E-Value=7.9) Length = 251 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 529 RLY + + + L +T+Y++ IR V+ YAS FA+ +L+ +Q R +IA Sbjct: 109 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLFDALENVQRRALKIA 167 >SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) Length = 488 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/39 (35%), Positives = 27/39 (69%) Frame = -3 Query: 648 TLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 +LY + +RP + YAS V+A A T+++S++ +Q R ++ Sbjct: 392 SLYLSIVRPTVGYASEVWAPQAITDMRSVEALQRRATKV 430 >SB_59601| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 370 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/66 (27%), Positives = 30/66 (45%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 167 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 225 Query: 522 APWFLR 505 W ++ Sbjct: 226 IHWRIK 231 >SB_23375| Best HMM Match : PCI (HMM E-Value=9.5) Length = 208 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 529 RLY + + + L + +T+Y++ IR V+ YAS FA+ +L+ +Q R +IA Sbjct: 66 RLYALRVLKKCGLDVIELITVYRSLIRSVIEYASEAFANLPNYLSDALEKVQRRALKIA 124 >SB_54439| Best HMM Match : SNF (HMM E-Value=0) Length = 701 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 529 RLY + + + L +T+Y++ IR V+ YAS FA+ +L+ +Q R +IA Sbjct: 640 RLYALRILKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 698 >SB_37723| Best HMM Match : RVT_1 (HMM E-Value=0.054) Length = 596 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAV 526 RLY + + + L +T+Y++ IR V+ YAS FA+ +L+ +Q R +IA Sbjct: 426 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIAF 485 Query: 525 GA 520 A Sbjct: 486 PA 487 >SB_12742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1077 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 529 RLY + + + L +T+Y++ IR V+ YAS FA+ +L+ +Q R +IA Sbjct: 963 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSNALENVQRRALKIA 1021 >SB_53921| Best HMM Match : Viral_P18 (HMM E-Value=2.6) Length = 322 Score = 33.1 bits (72), Expect = 0.28 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 RLY + L ++ LS+ + T+Y IR V+ YAS V+A + L+ IQ R +I Sbjct: 181 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 238 >SB_52416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 451 Score = 33.1 bits (72), Expect = 0.28 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 RLY + L ++ LS+ + T+Y IR V+ YAS V+A + L+ IQ R +I Sbjct: 310 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 367 >SB_36270| Best HMM Match : Viral_P18 (HMM E-Value=4.9) Length = 283 Score = 33.1 bits (72), Expect = 0.28 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 RLY + L ++ LS+ + T+Y IR V+ YAS V+A + L+ IQ R +I Sbjct: 181 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 238 >SB_32142| Best HMM Match : RVT_1 (HMM E-Value=2.29953e-42) Length = 590 Score = 33.1 bits (72), Expect = 0.28 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 515 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 573 Query: 522 APW 514 W Sbjct: 574 IHW 576 >SB_29973| Best HMM Match : RVT_1 (HMM E-Value=5.2e-21) Length = 499 Score = 33.1 bits (72), Expect = 0.28 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 RLY + L ++ LS+ + T+Y IR V+ YAS V+A + L+ IQ R +I Sbjct: 401 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 458 >SB_23846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 33.1 bits (72), Expect = 0.28 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 529 RLY + + + L +T+Y++ IR V+ YAS FA+ +L+ +Q R +IA Sbjct: 41 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALEDVQRRALKIA 99 >SB_23599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 33.1 bits (72), Expect = 0.28 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 RLY + L ++ LS+ + T+Y IR V+ YAS V+A + L+ IQ R +I Sbjct: 143 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 200 >SB_9383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 33.1 bits (72), Expect = 0.28 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 529 RLY + + + L +T+Y++ IR V+ YAS FA+ L+ +Q R +IA Sbjct: 161 RLYALRVLKKCGLDAIELITVYRSFIRSVIEYASAAFANLPNCLCDDLENVQRRALKIA 219 >SB_8735| Best HMM Match : RVT_1 (HMM E-Value=2.00386e-43) Length = 661 Score = 33.1 bits (72), Expect = 0.28 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 464 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 522 Query: 522 APW 514 W Sbjct: 523 IHW 525 >SB_8006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 33.1 bits (72), Expect = 0.28 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 529 RLY + + + L +T+Y++ IR V+ YAS FA+ +L+ +Q R +IA Sbjct: 81 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 139 >SB_5462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 33.1 bits (72), Expect = 0.28 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 529 RLY + + + L +T+Y++ IR V+ YAS FA+ +L+ +Q R +IA Sbjct: 195 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASATFANLPNYLSDALENVQRRTLKIA 253 >SB_55213| Best HMM Match : Viral_P18 (HMM E-Value=2.6) Length = 371 Score = 33.1 bits (72), Expect = 0.28 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 RLY + L ++ LS+ + T+Y IR V+ YAS V+A + L+ IQ R +I Sbjct: 181 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 238 >SB_53437| Best HMM Match : DUF1126 (HMM E-Value=5.1) Length = 92 Score = 33.1 bits (72), Expect = 0.28 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 3 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 61 Query: 522 APW 514 W Sbjct: 62 IHW 64 >SB_52244| Best HMM Match : RVT_1 (HMM E-Value=9.5e-20) Length = 523 Score = 33.1 bits (72), Expect = 0.28 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 RLY + L ++ LS+ + T+Y IR V+ YAS V+A + L+ IQ R +I Sbjct: 382 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 439 >SB_51865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 244 Score = 33.1 bits (72), Expect = 0.28 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 529 RLY + + + L +T+Y++ IR V+ YAS FA+ +L+ +Q R +IA Sbjct: 181 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 239 >SB_43560| Best HMM Match : DUF633 (HMM E-Value=4.4) Length = 284 Score = 33.1 bits (72), Expect = 0.28 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 RLY + L ++ LS+ + T+Y IR V+ YAS V+A + L+ IQ R +I Sbjct: 143 RLYALRLLKKAGLSVHDLCTIYCALIRSVLEYASPVWAALPEYLSEHLESIQKRALKI 200 >SB_33864| Best HMM Match : WD40 (HMM E-Value=2.1) Length = 397 Score = 33.1 bits (72), Expect = 0.28 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 529 RLY + + + L +T+Y++ IR V+ YAS FA+ +L+ +Q R +IA Sbjct: 255 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 313 >SB_27484| Best HMM Match : RVT_1 (HMM E-Value=0.035) Length = 322 Score = 33.1 bits (72), Expect = 0.28 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 233 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 291 Query: 522 APW 514 W Sbjct: 292 IHW 294 >SB_25973| Best HMM Match : zf-C2H2 (HMM E-Value=0.42) Length = 416 Score = 33.1 bits (72), Expect = 0.28 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 193 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 251 Query: 522 APW 514 W Sbjct: 252 IHW 254 >SB_18416| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 33.1 bits (72), Expect = 0.28 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 1/79 (1%) Frame = -3 Query: 657 NKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDL 481 +++T Y + IRPVM YAS V+ ++ L+ +Q R G + DL L Sbjct: 118 HRITDYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSL 177 Query: 480 ELDSFSKYLQSASLRHFEK 424 DS Q A L F K Sbjct: 178 NWDSLEVRRQLAQLCLFYK 196 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 33.1 bits (72), Expect = 0.28 Identities = 26/78 (33%), Positives = 33/78 (42%), Gaps = 1/78 (1%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLE 478 K Y + IRPVM YAS V+ ++ L+ +Q R G + DL L Sbjct: 436 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLN 495 Query: 477 LDSFSKYLQSASLRHFEK 424 LDS Q A L F K Sbjct: 496 LDSLEVRRQLAQLCLFYK 513 >SB_35414| Best HMM Match : NinE (HMM E-Value=8.4) Length = 172 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/67 (25%), Positives = 34/67 (50%) Frame = -3 Query: 678 RSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPWFLRNV 499 RS L L ++ + I+PVM YA+V+++ + + + Q R R + A ++ Sbjct: 35 RSYLPLNQRINHFNAIIKPVMNYANVIWSTCDKESQYRILKFQKRAARTILYAGRLTPSI 94 Query: 498 DLHDDLE 478 +L + L+ Sbjct: 95 ELFNRLQ 101 >SB_13193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 415 Score = 32.7 bits (71), Expect = 0.37 Identities = 22/69 (31%), Positives = 32/69 (46%) Frame = -2 Query: 283 HKHRSPSSSNPSLATKGSTSELTHRHSPLSFSPDLLSGSRFRXRW*ILRSTALARVSVSN 104 H+ +P S+ + T + ELTH +SP S + L RFR R +L + N Sbjct: 224 HRVPNPGESHEAEETSSESFELTHENSPRHISVEDLPKGRFRSR-------SLVHPATRN 276 Query: 103 SPVEPRELT 77 V+PR T Sbjct: 277 FAVKPRSGT 285 >SB_777| Best HMM Match : DUF1126 (HMM E-Value=5.1) Length = 173 Score = 32.7 bits (71), Expect = 0.37 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 84 KLSSRVWENKKLTISTKITVYRACILNTLLYGSESWTTYARQE-KRLNTFHMRCLRRILG 142 Query: 522 APW 514 W Sbjct: 143 IHW 145 >SB_40765| Best HMM Match : DX (HMM E-Value=1.4) Length = 278 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = -3 Query: 660 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFC 538 R KVT Y +RP++ YAS + + ++ SL+ +Q +RFC Sbjct: 118 RVKVTAYTAIVRPMLEYASAAWDPHLKKDIASLEKVQRKAARFC 161 >SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 32.7 bits (71), Expect = 0.37 Identities = 32/113 (28%), Positives = 49/113 (43%), Gaps = 4/113 (3%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG----APWFLRNVDLHD 487 K YK+ + P + YAS + + ++K ++ +Q R P + N+ + Sbjct: 251 KEAAYKSLVLPHLEYASSAWDPWLKKHVKQIEKVQRRAGSFVKNCWDRTPGTVTNI--LN 308 Query: 486 DLELDSFSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRRPKH 328 DLE SK Q A L F KA ++ L IPD +DR R+ R H Sbjct: 309 DLEWPPLSKRRQDARLTLFYKAVNKKSAL------KIPDNIDRR-TRQLRSSH 354 >SB_38574| Best HMM Match : WW (HMM E-Value=4.9) Length = 256 Score = 32.7 bits (71), Expect = 0.37 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 529 RLY + + + L +T+Y++ IR V+ YAS+ FA+ L+ +Q R +IA Sbjct: 114 RLYALRVLKKCGLDAIELITVYRSPIRSVIEYASIAFANLQNYLSDVLENVQRRVLKIA 172 >SB_33932| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 541 Score = 32.7 bits (71), Expect = 0.37 Identities = 18/40 (45%), Positives = 24/40 (60%) Frame = -3 Query: 651 VTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 V +Y + IR V+ YASVVFA+ + L+ IQ R RI Sbjct: 426 VLVYCSLIRSVIEYASVVFANLPQYLANYLEAIQKRALRI 465 >SB_4548| Best HMM Match : WD40 (HMM E-Value=6.7e-35) Length = 844 Score = 32.7 bits (71), Expect = 0.37 Identities = 16/70 (22%), Positives = 34/70 (48%) Frame = -3 Query: 669 LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPWFLRNVDLH 490 LS+ + + I+P+M Y V+ ++ ++Q R RI W+ ++ L Sbjct: 678 LSMTARKMFFNVLIQPLMDYCITVWGDNLIELDNTMLLLQKRAARIIPDKKWYDHSMALF 737 Query: 489 DDLELDSFSK 460 ++L ++ F+K Sbjct: 738 EELNIEPFTK 747 >SB_2234| Best HMM Match : RVT_1 (HMM E-Value=1.3e-19) Length = 476 Score = 32.7 bits (71), Expect = 0.37 Identities = 18/40 (45%), Positives = 24/40 (60%) Frame = -3 Query: 651 VTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 V +Y + IR V+ YASVVFA+ + L+ IQ R RI Sbjct: 361 VLVYCSLIRSVIEYASVVFANLPQYLANYLEAIQKRALRI 400 >SB_59170| Best HMM Match : RVT_1 (HMM E-Value=0.13) Length = 679 Score = 32.3 bits (70), Expect = 0.49 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -3 Query: 702 RLYPMLC-SRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 RLY + +S LS N + +Y + +RPV+ YAS V++ ++ ++ +Q + RI Sbjct: 537 RLYAIRALKKSGLSSNNLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 594 >SB_57709| Best HMM Match : RVT_1 (HMM E-Value=0.00081) Length = 754 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = -3 Query: 651 VTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA 520 +T+Y++ IR V+ YAS FA+ +L+ +Q R +IA A Sbjct: 575 ITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIAFPA 618 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = -3 Query: 660 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFC 538 R KVT Y +RP++ YAS + + ++ SL+ +Q +RFC Sbjct: 909 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 952 >SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 174 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = -3 Query: 660 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFC 538 R KVT Y +RP++ YAS + + ++ SL+ +Q +RFC Sbjct: 14 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 57 >SB_30875| Best HMM Match : Rubredoxin (HMM E-Value=1.6) Length = 1130 Score = 32.3 bits (70), Expect = 0.49 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 2/60 (3%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLK-SLQVIQSRFCRIA 529 RLY + L R+ + + + + Y TC+RP++ Y + + HA LK L+ IQ IA Sbjct: 271 RLYFLVLLKRTIVPVSDIIGFYDTCVRPILEYCAPLSYHAIPAYLKEDLEHIQKSALSIA 330 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = -3 Query: 660 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFC 538 R KVT Y +RP++ YAS + + ++ SL+ +Q +RFC Sbjct: 215 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 258 >SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 361 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = -3 Query: 660 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFC 538 R KVT Y +RP++ YAS + + ++ SL+ +Q +RFC Sbjct: 201 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 244 >SB_15881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 796 Score = 32.3 bits (70), Expect = 0.49 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 678 RSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNL-KSLQVIQSRFCRI 532 RS L V+ ++TC+RP+ YA V+ + + L SL+ +Q R RI Sbjct: 671 RSGLGKSVLVSFFRTCVRPITEYACPVYHDSLPSYLSNSLEQVQRRGLRI 720 >SB_5514| Best HMM Match : TB (HMM E-Value=4.3) Length = 243 Score = 32.3 bits (70), Expect = 0.49 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 529 RLY + + + L +T+Y++ IR V+ YAS FA+ +L+ +Q R +IA Sbjct: 44 RLYALRVLKKWGLDAIELITVYRSLIRSVIEYASAAFANLPNYLSDALENVQRRALKIA 102 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = -3 Query: 660 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFC 538 R KVT Y +RP++ YAS + + ++ SL+ +Q +RFC Sbjct: 447 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 490 >SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 864 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = -3 Query: 660 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFC 538 R KVT Y +RP++ YAS + + ++ SL+ +Q +RFC Sbjct: 631 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 674 >SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) Length = 863 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = -3 Query: 660 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFC 538 R KVT Y +RP++ YAS + + ++ SL+ +Q +RFC Sbjct: 733 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 776 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = -3 Query: 660 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFC 538 R KVT Y +RP++ YAS + + ++ SL+ +Q +RFC Sbjct: 421 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 464 >SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = -3 Query: 660 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFC 538 R KVT Y +RP++ YAS + + ++ SL+ +Q +RFC Sbjct: 664 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 707 >SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 719 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = -3 Query: 660 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFC 538 R KVT Y +RP++ YAS + + ++ SL+ +Q +RFC Sbjct: 623 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 666 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = -3 Query: 660 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFC 538 R KVT Y +RP++ YAS + + ++ SL+ +Q +RFC Sbjct: 506 RVKVTAYTAIVRPMLEYASAAWDPYLQKDIASLEKVQRKAARFC 549 >SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 546 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 3/44 (6%) Frame = -3 Query: 660 RNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFC 538 R KVT Y +RP++ YAS + + ++ SL+ +Q +RFC Sbjct: 439 RVKVTAYTAIVRPMLEYASAAWDPHLQKDIASLEKVQRKAARFC 482 >SB_15890| Best HMM Match : ArsC (HMM E-Value=0.94) Length = 310 Score = 32.3 bits (70), Expect = 0.49 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -3 Query: 702 RLYPMLC-SRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 RLY + +S LS N + +Y + +RPV+ YAS V++ ++ ++ +Q + RI Sbjct: 168 RLYAIRALKKSGLSSNNLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 225 >SB_20315| Best HMM Match : RVT_1 (HMM E-Value=1.4e-21) Length = 479 Score = 31.9 bits (69), Expect = 0.64 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 529 RLY + + + L +T+Y++ IR V+ Y+S FA+ +L+ +Q R +IA Sbjct: 364 RLYALRVLKKCGLDAIELITVYRSLIRSVIEYSSAAFANLPNYLSDALENVQRRALKIA 422 >SB_7179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.9 bits (69), Expect = 0.64 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -3 Query: 702 RLYPML-CSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 544 RLY + R +S + + +Y++ +R + YASVVFA R SL +Q R Sbjct: 7 RLYAIRQLKRCGVSTDDIIVVYRSLVRSTLEYASVVFADLPRYPSDSLVRVQKR 60 >SB_7040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 31.9 bits (69), Expect = 0.64 Identities = 20/84 (23%), Positives = 40/84 (47%), Gaps = 1/84 (1%) Frame = -3 Query: 726 RPRRVILGRLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAA-RTNLKSLQVIQ 550 R + I GR+ + + L ++ + Y I+P+ +YA V+ A+ + +L +Q Sbjct: 134 RTYKKIAGRIGVLNKIKGCLPIKQRTNFYNAMIKPLFSYAGTVWQTASTKDSLSKFLTLQ 193 Query: 549 SRFCRIAVGAPWFLRNVDLHDDLE 478 R R+ + A +V L + L+ Sbjct: 194 KRAARLILNAEPRAPSVPLFNRLQ 217 >SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4232 Score = 31.9 bits (69), Expect = 0.64 Identities = 15/40 (37%), Positives = 26/40 (65%) Frame = -3 Query: 663 LRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 544 + + VT+Y + IRP+ YASV+F++ ++L+ IQ R Sbjct: 4163 VEDMVTVYCSLIRPITEYASVIFSNIPCYLSEALEKIQRR 4202 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 31.9 bits (69), Expect = 0.64 Identities = 18/60 (30%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAV 526 RLY + + + +++ VT+Y + IR + YASV+F + ++L+ IQ R +I + Sbjct: 2747 RLYALRTLKKCGVPVKDMVTVYCSLIRSITEYASVIFPNIPCYLSEALEKIQRRALKIII 2806 >SB_35861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 31.9 bits (69), Expect = 0.64 Identities = 29/93 (31%), Positives = 37/93 (39%), Gaps = 1/93 (1%) Frame = -3 Query: 699 LYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA 520 L L + LS K Y + IRPVM YAS V+ ++ L+ +Q R G Sbjct: 158 LNEQLTKQIVLSQSVKERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGT 217 Query: 519 -PWFLRNVDLHDDLELDSFSKYLQSASLRHFEK 424 + DL L DS Q A L F K Sbjct: 218 YDPRASSSDLVKSLNWDSLEVRRQLAQLCLFYK 250 >SB_19895| Best HMM Match : PHD (HMM E-Value=3.8e-08) Length = 335 Score = 31.9 bits (69), Expect = 0.64 Identities = 29/95 (30%), Positives = 46/95 (48%), Gaps = 2/95 (2%) Frame = -3 Query: 699 LYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR--IAV 526 L P+L S+S LSL + +Y +C+R M YA +A + ++L LQ + R A+ Sbjct: 232 LLPVLSSKS-LSLCTRGKVYSSCVRSAMLYAGECWAPKS-SDLTRLQRSERAMLRWMCAL 289 Query: 525 GAPWFLRNVDLHDDLELDSFSKYLQSASLRHFEKA 421 + D L ++S L+ A LR F +A Sbjct: 290 KPEDDTSLSTIRDRLGIESLELALRKARLRWFGQA 324 >SB_4311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.9 bits (69), Expect = 0.64 Identities = 14/61 (22%), Positives = 31/61 (50%) Frame = -3 Query: 642 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPWFLRNVDLHDDLELDSFS 463 + I+P+M Y V+ + ++ ++Q R RI W+ ++ L ++L ++ F+ Sbjct: 3 FNALIQPLMDYCITVWGDNLIEHDNTILLLQKRAARIIAYKKWYDHSMALFEELNIEPFT 62 Query: 462 K 460 K Sbjct: 63 K 63 >SB_53893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 764 Score = 31.5 bits (68), Expect = 0.85 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -3 Query: 702 RLYPML-CSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 544 RLY + R +S + + +Y++ +R + YASVVFA R SL +Q R Sbjct: 615 RLYAIRQLKRCGVSTDDIIVVYRSLVRSTLEYASVVFADLPRYLSDSLVRVQKR 668 >SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 K + Y+T +RP + YA+ + + N+K +++IQ R R Sbjct: 573 KDSAYRTLVRPKLEYATSAWNPYTQCNIKKIEMIQRRAAR 612 >SB_24320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 31.5 bits (68), Expect = 0.85 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 1/84 (1%) Frame = -3 Query: 726 RPRRVILGRLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKSLQVIQ 550 R + I GR+ + + L L+ + Y I+P+ +YA V+ A+ + L +Q Sbjct: 72 RTYKKIAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQ 131 Query: 549 SRFCRIAVGAPWFLRNVDLHDDLE 478 R R+ + A +V L + L+ Sbjct: 132 KRAARLILNAEPRAPSVPLFNKLQ 155 >SB_7051| Best HMM Match : RVT_1 (HMM E-Value=0.064) Length = 756 Score = 31.5 bits (68), Expect = 0.85 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = -3 Query: 702 RLYPML-CSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 544 RLY + R +S + + +Y++ +R + YASVVFA R SL +Q R Sbjct: 131 RLYAIRQLKRCGVSTDDIIVVYRSLVRSTLEYASVVFADLPRYLSDSLVRVQKR 184 >SB_46102| Best HMM Match : RVT_1 (HMM E-Value=2.6e-14) Length = 595 Score = 31.5 bits (68), Expect = 0.85 Identities = 15/41 (36%), Positives = 25/41 (60%) Frame = -3 Query: 651 VTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIA 529 +T+Y++ IR V+ YAS FA+ +L+ +Q R +IA Sbjct: 480 ITVYRSLIRSVIEYASAAFANFPNYLSDALENVQRRALKIA 520 >SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) Length = 267 Score = 31.5 bits (68), Expect = 0.85 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 K + Y+T +RP + YA+ + + N+K +++IQ R R Sbjct: 201 KDSAYRTLVRPKLEYATSAWNPYTQCNIKKIEMIQRRAAR 240 >SB_50942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 638 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/40 (35%), Positives = 26/40 (65%) Frame = -3 Query: 651 VTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 V +Y + IR ++ YA+VVF++ + ++L+ +Q R RI Sbjct: 132 VAVYCSLIRSILEYATVVFSNLPKYLSEALEKVQKRSLRI 171 >SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) Length = 593 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 1/84 (1%) Frame = -3 Query: 726 RPRRVILGRLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKSLQVIQ 550 R + I GR+ + + L L+ + Y I+P+ +YA V+ A+ + L +Q Sbjct: 399 RTYKKIAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQ 458 Query: 549 SRFCRIAVGAPWFLRNVDLHDDLE 478 R R+ + A +V L + L+ Sbjct: 459 KRAARLILNAEPRAPSVPLFNRLQ 482 >SB_27289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 605 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 2/55 (3%) Frame = -3 Query: 702 RLYPMLC-SRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLK-SLQVIQSR 544 RLY ++ R+++ ++ + Y + IRPV+ Y + VF HA + L ++ +Q R Sbjct: 469 RLYFIVSLRRARVPTKDIIDFYCSAIRPVLEYCAAVFHHALPSYLSDDIERVQKR 523 >SB_12986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 1/84 (1%) Frame = -3 Query: 726 RPRRVILGRLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKSLQVIQ 550 R + I GR+ + + L L+ + Y I+P+ +YA V+ A+ + L +Q Sbjct: 74 RTYKKIAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQ 133 Query: 549 SRFCRIAVGAPWFLRNVDLHDDLE 478 R R+ + A +V L + L+ Sbjct: 134 KRAARLILNAEPRAPSVPLFNRLQ 157 >SB_7633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 1/84 (1%) Frame = -3 Query: 726 RPRRVILGRLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKSLQVIQ 550 R + I GR+ + + L ++ + Y I+P+ +YA V+ A+ + L +Q Sbjct: 193 RTYKKIAGRIGVLNKIKGCLPIKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQ 252 Query: 549 SRFCRIAVGAPWFLRNVDLHDDLE 478 R R+ + A +V L + L+ Sbjct: 253 KRAARLILNAEHRAPSVPLFNRLQ 276 >SB_51996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 1/84 (1%) Frame = -3 Query: 726 RPRRVILGRLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKSLQVIQ 550 R + I GR+ + + L L+ + Y I+P+ +YA V+ A+ + L +Q Sbjct: 182 RTYKKIAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQ 241 Query: 549 SRFCRIAVGAPWFLRNVDLHDDLE 478 R R+ + A +V L + L+ Sbjct: 242 KRAARLILNAEPRAPSVPLFNRLQ 265 >SB_43796| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 352 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/54 (25%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = -3 Query: 687 LCSRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 L R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R+ Sbjct: 294 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCARV 347 >SB_41403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1415 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 1/84 (1%) Frame = -3 Query: 726 RPRRVILGRLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKSLQVIQ 550 R + I GR+ + + L L+ + Y I+P+ +YA V+ A+ + L +Q Sbjct: 193 RTYKKIAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQ 252 Query: 549 SRFCRIAVGAPWFLRNVDLHDDLE 478 R R+ + A +V L + L+ Sbjct: 253 KRAARLILNAEPRAPSVPLFNRLQ 276 >SB_6674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 303 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 1/84 (1%) Frame = -3 Query: 726 RPRRVILGRLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKSLQVIQ 550 R + I GR+ + + L L+ + Y I+P+ +YA V+ A+ + L +Q Sbjct: 109 RTYKKIAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQ 168 Query: 549 SRFCRIAVGAPWFLRNVDLHDDLE 478 R R+ + A +V L + L+ Sbjct: 169 KRAARLILNAEPRAPSVPLFNRLQ 192 >SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) Length = 890 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 1/84 (1%) Frame = -3 Query: 726 RPRRVILGRLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKSLQVIQ 550 R + I GR+ + + L L+ + Y I+P+ +YA V+ A+ + L +Q Sbjct: 696 RTYKKIAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQ 755 Query: 549 SRFCRIAVGAPWFLRNVDLHDDLE 478 R R+ + A +V L + L+ Sbjct: 756 KRAARLILNAEPRAPSVPLFNRLQ 779 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 30.7 bits (66), Expect = 1.5 Identities = 25/78 (32%), Positives = 32/78 (41%), Gaps = 1/78 (1%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLE 478 K Y + IRPVM YAS V+ ++ L+ +Q R G + DL L Sbjct: 755 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLN 814 Query: 477 LDSFSKYLQSASLRHFEK 424 DS Q A L F K Sbjct: 815 WDSLEVRRQLAQLCLFYK 832 >SB_43127| Best HMM Match : DUF1690 (HMM E-Value=2.2) Length = 449 Score = 30.7 bits (66), Expect = 1.5 Identities = 25/78 (32%), Positives = 32/78 (41%), Gaps = 1/78 (1%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLE 478 K Y + IRPVM YAS V+ ++ L+ +Q R G + DL L Sbjct: 159 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLN 218 Query: 477 LDSFSKYLQSASLRHFEK 424 DS Q A L F K Sbjct: 219 WDSLEVRRQLAQLCLFYK 236 >SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 198 Score = 30.7 bits (66), Expect = 1.5 Identities = 25/78 (32%), Positives = 32/78 (41%), Gaps = 1/78 (1%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLE 478 K Y + IRPVM YAS V+ ++ L+ +Q R G + DL L Sbjct: 35 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLN 94 Query: 477 LDSFSKYLQSASLRHFEK 424 DS Q A L F K Sbjct: 95 WDSLEVRRQLAQLCLFYK 112 >SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) Length = 284 Score = 30.7 bits (66), Expect = 1.5 Identities = 25/78 (32%), Positives = 32/78 (41%), Gaps = 1/78 (1%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLE 478 K Y + IRPVM YAS V+ ++ L+ +Q R G + DL L Sbjct: 121 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLN 180 Query: 477 LDSFSKYLQSASLRHFEK 424 DS Q A L F K Sbjct: 181 WDSLEVRRQLAQLCLFYK 198 >SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) Length = 243 Score = 30.7 bits (66), Expect = 1.5 Identities = 25/78 (32%), Positives = 32/78 (41%), Gaps = 1/78 (1%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLE 478 K Y + IRPVM YAS V+ ++ L+ +Q R G + DL L Sbjct: 80 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLN 139 Query: 477 LDSFSKYLQSASLRHFEK 424 DS Q A L F K Sbjct: 140 WDSLEVRRQLAQLCLFYK 157 >SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2529 Score = 30.7 bits (66), Expect = 1.5 Identities = 25/78 (32%), Positives = 32/78 (41%), Gaps = 1/78 (1%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLE 478 K Y + IRPVM YAS V+ ++ L+ +Q R G + DL L Sbjct: 1462 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLN 1521 Query: 477 LDSFSKYLQSASLRHFEK 424 DS Q A L F K Sbjct: 1522 WDSLEVRRQLAQLCLFYK 1539 >SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) Length = 243 Score = 30.7 bits (66), Expect = 1.5 Identities = 25/78 (32%), Positives = 32/78 (41%), Gaps = 1/78 (1%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLE 478 K Y + IRPVM YAS V+ ++ L+ +Q R G + DL L Sbjct: 80 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLN 139 Query: 477 LDSFSKYLQSASLRHFEK 424 DS Q A L F K Sbjct: 140 WDSLEVRRQLAQLCLFYK 157 >SB_51096| Best HMM Match : Baculo_ME53 (HMM E-Value=5.6) Length = 238 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 1/70 (1%) Frame = -3 Query: 726 RPRRVILGRLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKSLQVIQ 550 R + I GR+ + + L L+ + Y I+P+ +YA V+ A+ + L +Q Sbjct: 134 RTYKKIAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQ 193 Query: 549 SRFCRIAVGA 520 R R+ + A Sbjct: 194 KRAARLILNA 203 >SB_35242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/41 (29%), Positives = 24/41 (58%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 K + Y+T +RP + YA++ + + N+ +++IQ R I Sbjct: 175 KDSAYRTLVRPKLEYATIAWNPYTQCNINKIEMIQRRAASI 215 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 30.7 bits (66), Expect = 1.5 Identities = 25/78 (32%), Positives = 32/78 (41%), Gaps = 1/78 (1%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLE 478 K Y + IRPVM YAS V+ ++ L+ +Q R G + DL L Sbjct: 446 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLN 505 Query: 477 LDSFSKYLQSASLRHFEK 424 DS Q A L F K Sbjct: 506 WDSLEVRRQLAQLCLFYK 523 >SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) Length = 409 Score = 30.7 bits (66), Expect = 1.5 Identities = 25/78 (32%), Positives = 32/78 (41%), Gaps = 1/78 (1%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLE 478 K Y + IRPVM YAS V+ ++ L+ +Q R G + DL L Sbjct: 259 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLN 318 Query: 477 LDSFSKYLQSASLRHFEK 424 DS Q A L F K Sbjct: 319 WDSLEVRRQLAQLCLFYK 336 >SB_18362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/84 (25%), Positives = 39/84 (46%), Gaps = 1/84 (1%) Frame = -3 Query: 726 RPRRVILGRLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKSLQVIQ 550 R + I GR+ + + L L+ + Y I+P+ +YA V+ A+ + L +Q Sbjct: 69 RTYKKIAGRIGVLNKIKGCLPLKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLTRFLTLQ 128 Query: 549 SRFCRIAVGAPWFLRNVDLHDDLE 478 R R+ + A +V L + L+ Sbjct: 129 KRAARLILNAEPRAPSVPLFNRLQ 152 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 30.7 bits (66), Expect = 1.5 Identities = 25/78 (32%), Positives = 32/78 (41%), Gaps = 1/78 (1%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLE 478 K Y + IRPVM YAS V+ ++ L+ +Q R G + DL L Sbjct: 674 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLN 733 Query: 477 LDSFSKYLQSASLRHFEK 424 DS Q A L F K Sbjct: 734 WDSLEVRRQLAQLCLFYK 751 >SB_9954| Best HMM Match : SLH (HMM E-Value=1.1) Length = 132 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -3 Query: 651 VTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 544 + +Y++ +R + YASVVFA R SL+ +Q R Sbjct: 6 LVVYRSLVRSTLEYASVVFADLPRYLSDSLERVQKR 41 >SB_8726| Best HMM Match : Pox_F16 (HMM E-Value=5.2) Length = 244 Score = 30.7 bits (66), Expect = 1.5 Identities = 25/78 (32%), Positives = 32/78 (41%), Gaps = 1/78 (1%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLE 478 K Y + IRPVM YAS V+ ++ L+ +Q R G + DL L Sbjct: 141 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTGTYDPRASSSDLVKSLN 200 Query: 477 LDSFSKYLQSASLRHFEK 424 DS Q A L F K Sbjct: 201 WDSLEVRRQLAQLCLFYK 218 >SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) Length = 434 Score = 30.3 bits (65), Expect = 2.0 Identities = 16/63 (25%), Positives = 32/63 (50%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 R+ ++ R+ + K+ LYK+ + P +TY + + ++ + L+ +Q R R AV Sbjct: 333 RIGVLMRLRNLIPTNAKLVLYKSAVLPYLTYCHLTWHFCKASDSRKLERLQERALR-AVF 391 Query: 522 APW 514 W Sbjct: 392 KDW 394 >SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2346 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -3 Query: 702 RLYPMLC-SRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 RLY + +S LS + + +Y + +RPV+ YAS V++ ++ ++ +Q + RI Sbjct: 1019 RLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 1076 >SB_44720| Best HMM Match : Helicase_C (HMM E-Value=0.59) Length = 625 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/53 (37%), Positives = 26/53 (49%) Frame = -2 Query: 382 LHTRPSRPNGKPSTSPKARHYGSS*SINGAFRHHKHRSPSSSNPSLATKGSTS 224 L P RP G S K+ GS S + KH SPS S+ + TKG+T+ Sbjct: 472 LSAPPPRPQGNLLESLKSSE-GSMESTSNDSPLRKHSSPSLSDAIMRTKGTTN 523 >SB_38681| Best HMM Match : RVT_1 (HMM E-Value=0.0082) Length = 559 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -3 Query: 702 RLYPMLC-SRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 RLY + +S LS + + +Y + +RPV+ YAS V++ ++ ++ +Q + RI Sbjct: 417 RLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 474 >SB_24260| Best HMM Match : Rotavirus_VP7 (HMM E-Value=7.7) Length = 319 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 1/84 (1%) Frame = -3 Query: 726 RPRRVILGRLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKSLQVIQ 550 R + I GR+ + + L ++ + Y I+P+ +YA V+ A+ + L +Q Sbjct: 175 RTYKKIAGRIGVLNKIKGCLPIKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQ 234 Query: 549 SRFCRIAVGAPWFLRNVDLHDDLE 478 R R+ + A +V L + L+ Sbjct: 235 KRAARLILNAEPRAPSVPLFNRLQ 258 >SB_18090| Best HMM Match : RVT_1 (HMM E-Value=0.59) Length = 427 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -3 Query: 702 RLYPMLC-SRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 RLY + +S LS + + +Y + +RPV+ YAS V++ ++ ++ +Q + RI Sbjct: 285 RLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 342 >SB_17448| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 890 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 RLY + + + + + VT+Y + IR V YASV+F++ + L+ IQ R +I Sbjct: 773 RLYALRTLKKCGVPVEDMVTVYCSLIRSVTEYASVIFSNIPCYLSEVLEKIQRRALKI 830 >SB_17216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/84 (23%), Positives = 39/84 (46%), Gaps = 1/84 (1%) Frame = -3 Query: 726 RPRRVILGRLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTN-LKSLQVIQ 550 R + I GR+ + + L ++ + Y I+P+ +YA V+ A+ + L +Q Sbjct: 74 RTYKKIAGRIGVLNKIKGCLPIKQRTNFYNAMIKPLFSYAGTVWQTASTKDCLSRFLTLQ 133 Query: 549 SRFCRIAVGAPWFLRNVDLHDDLE 478 R R+ + A +V L + L+ Sbjct: 134 KRAARLILNAEPRAPSVPLFNRLQ 157 >SB_16275| Best HMM Match : RVT_1 (HMM E-Value=1.7e-16) Length = 409 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -3 Query: 702 RLYPM-LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 RLY + +S LS + + +Y + +RPV+ YAS V++ ++ ++ +Q + RI Sbjct: 293 RLYAIGALKKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 350 >SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -3 Query: 702 RLYPMLC-SRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 RLY + +S LS + + +Y + +RPV+ YAS V++ ++ ++ +Q + RI Sbjct: 586 RLYAIRALKKSGLSSNDLIQVYCSTMRPVLEYASPVWSALPEYLVELVESVQKKVLRI 643 >SB_52890| Best HMM Match : PH (HMM E-Value=1e-06) Length = 449 Score = 29.9 bits (64), Expect = 2.6 Identities = 25/93 (26%), Positives = 38/93 (40%), Gaps = 2/93 (2%) Frame = -3 Query: 678 RSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPWF--LR 505 R K L ++T+Y+ CI + Y S + AR K L R R +G W + Sbjct: 43 RVKGYLNVQITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLRRILGIHWSDKVT 101 Query: 504 NVDLHDDLELDSFSKYLQSASLRHFEKAARHEN 406 N ++ + L + L+ LR R EN Sbjct: 102 NNEVLERSGLPTLFTLLRQRRLRWLGHVCRMEN 134 >SB_49650| Best HMM Match : RVT_1 (HMM E-Value=1.3) Length = 379 Score = 29.9 bits (64), Expect = 2.6 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -3 Query: 702 RLYPML-CSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 544 RLY + R S + + +Y++ +R + YASVVFA SL+ IQ R Sbjct: 235 RLYAIRQLKRCGASTDDIIVVYRSLVRSTLEYASVVFADLPGYLSDSLERIQKR 288 >SB_16546| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 124 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = -3 Query: 687 LCSRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 L R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R Sbjct: 72 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCAR 124 >SB_5302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -3 Query: 699 LYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFA 592 L P+L S+S LSLR + +Y +C+R YA +A Sbjct: 888 LLPVLSSKS-LSLRTRGKVYSSCVRSATLYAGECWA 922 >SB_270| Best HMM Match : PHD (HMM E-Value=0.0037) Length = 251 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/36 (41%), Positives = 22/36 (61%) Frame = -3 Query: 699 LYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFA 592 L P+L S+S LSLR + +Y +C+R YA +A Sbjct: 190 LLPVLSSKS-LSLRTRGKVYSSCVRSATLYAGECWA 224 >SB_58494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/60 (28%), Positives = 27/60 (45%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 84 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLHTFHMRCLRRILG 142 >SB_48446| Best HMM Match : Pkinase (HMM E-Value=1.2e-05) Length = 228 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = -3 Query: 687 LCSRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 L R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R Sbjct: 176 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCAR 228 >SB_46049| Best HMM Match : SH2 (HMM E-Value=6.4) Length = 252 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = -3 Query: 687 LCSRSK--LSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 L R+K LSL+ + Y + I+P++ Y ++V+ + ++ + Q R R Sbjct: 72 LLKRTKKFLSLKARTLFYHSLIQPILDYGAIVWGSTKKQHIDDMVKFQKRCAR 124 >SB_45899| Best HMM Match : Exo_endo_phos (HMM E-Value=0.011) Length = 707 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = -3 Query: 651 VTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 544 V +Y + IR ++ YASVVF++ + ++L+ +Q R Sbjct: 639 VAVYCSLIRSILEYASVVFSNLPKYLSEALEKVQKR 674 >SB_33068| Best HMM Match : Galactosyl_T (HMM E-Value=5.9e-37) Length = 646 Score = 29.9 bits (64), Expect = 2.6 Identities = 23/74 (31%), Positives = 36/74 (48%) Frame = -2 Query: 406 PSHRSRW*LHTRPSRPNGKPSTSPKARHYGSS*SINGAFRHHKHRSPSSSNPSLATKGST 227 P+ R L T+P RPN P+ + + +S S GA ++K S S+ P L + S+ Sbjct: 75 PTTNVRLTLLTQPPRPNQDPN---RKTNRAASGSWCGARTYNKRASTLSTQPRL-YQDSS 130 Query: 226 SELTHRHSPLSFSP 185 E T +H + P Sbjct: 131 KEQTEQHQRVGAEP 144 >SB_8964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/60 (28%), Positives = 27/60 (45%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 +L + KL++ K+T+Y+ CI + Y S + AR K L R R +G Sbjct: 84 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLHTFHMRCLRRILG 142 >SB_59555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 898 Score = 29.5 bits (63), Expect = 3.4 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -3 Query: 702 RLYPML-CSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 544 RLY + RS ++ + +Y IRP+M YA VFA + +L+ +Q R Sbjct: 687 RLYALRKLKRSGVADSEIIQVYCCLIRPIMEYACAVFADLPQYLSHALERVQKR 740 >SB_51640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 880 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -3 Query: 678 RSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 R+ + + K+ LYK+ I P +TY V+ + + L+ +Q R R Sbjct: 756 RNLIPVDAKLQLYKSAILPNLTYCHTVWHFCKAADARKLERVQERALR 803 >SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) Length = 490 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -3 Query: 678 RSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 R+ + + K+ LYK+ I P +TY V+ + + L+ +Q R R Sbjct: 385 RNLIPVDAKLQLYKSAILPNLTYCHTVWHFCKAADARKLERVQERALR 432 >SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) Length = 325 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 259 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 298 >SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 259 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 298 >SB_39979| Best HMM Match : RVT_1 (HMM E-Value=4.6e-12) Length = 792 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -2 Query: 796 SKVKYXGVTLDRGMTFRPHIKXYATAPRYFRTT 698 S K G+TLD MTF HI + + +RTT Sbjct: 748 SSYKLLGITLDGQMTFEVHIDELSKTFKTYRTT 780 >SB_38350| Best HMM Match : OCIA (HMM E-Value=6.7) Length = 537 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 223 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 262 >SB_33952| Best HMM Match : Lectin_C (HMM E-Value=3.1) Length = 311 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 175 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 214 >SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) Length = 388 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 259 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 298 >SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1360 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 815 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 854 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 3/39 (7%) Frame = -3 Query: 642 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFCR 535 YKT +RP + YAS V++ + +++ +Q +RFC+ Sbjct: 516 YKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 554 >SB_21287| Best HMM Match : Lectin_C (HMM E-Value=3.1) Length = 179 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 113 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 152 >SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) Length = 244 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 3/39 (7%) Frame = -3 Query: 642 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFCR 535 YKT +RP + YAS V++ + +++ +Q +RFC+ Sbjct: 98 YKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 136 >SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) Length = 769 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 703 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 742 >SB_8874| Best HMM Match : PhaG_MnhG_YufB (HMM E-Value=2.4) Length = 252 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 208 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 247 >SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) Length = 558 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/48 (29%), Positives = 25/48 (52%) Frame = -3 Query: 678 RSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 R+ + + K+ LYK+ I P +TY V+ + + L+ +Q R R Sbjct: 385 RNLIPVDAKLQLYKSAILPNLTYCHTVWHFCKAADARKLERVQERALR 432 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 883 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 922 >SB_43623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/40 (30%), Positives = 24/40 (60%) Frame = -3 Query: 651 VTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRI 532 +++Y I+P Y S V+ + +++ LQV+Q+R R+ Sbjct: 222 ISIYNALIKPHFGYCSEVWDTLGQGHVRRLQVLQNRAARV 261 >SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 689 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 3/39 (7%) Frame = -3 Query: 642 YKTCIRPVMTYASVVFAHAARTNLKSLQVIQ---SRFCR 535 YKT +RP + YAS V++ + +++ +Q +RFC+ Sbjct: 584 YKTLVRPQLEYASTVWSPHQEYLIDAIEAVQKKAARFCK 622 >SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 801 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 K + Y+T +RP + YA+ + + N+ +++IQ R R Sbjct: 673 KDSAYRTLVRPKLEYATSAWNPYTQCNINKIEMIQRRAAR 712 >SB_46063| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00015) Length = 798 Score = 29.1 bits (62), Expect = 4.5 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Frame = -3 Query: 702 RLYPML-CSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAV 526 RLY + R +S + + +Y++ +R + YASVVFA R SL ++ +++ Sbjct: 731 RLYAIRQLKRCGVSTDDIIVVYRSLVRSTLEYASVVFADLPRYLSDSLAESRNAPSPLSI 790 Query: 525 GAPWFLRNV 499 A W R + Sbjct: 791 RA-WITRKL 798 >SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) Length = 314 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVG 523 K Y + IRPVM YAS V+ ++ L+ +Q R G Sbjct: 259 KERAYFSMIRPVMEYASPVWNPFTDRDINKLEQVQKNAARFVTG 302 >SB_29434| Best HMM Match : Peptidase_A17 (HMM E-Value=3.1e-25) Length = 416 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 414 VVPPSQNGAAMPTVDTY*KSRAPGRR 491 VV P QNG +P TY +S PG R Sbjct: 16 VVSPYQNGTEIPFPQTYSRSHIPGSR 41 >SB_54846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -2 Query: 790 VKYXGVTLDRGMTFRPHIKXYAT 722 VKY GV +D+ +TF+ HI+ T Sbjct: 93 VKYLGVLIDKNLTFKYHIEHITT 115 >SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) Length = 323 Score = 29.1 bits (62), Expect = 4.5 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -2 Query: 790 VKYXGVTLDRGMTFRPHIKXYAT 722 VKY GV +D+ +TF+ HI+ T Sbjct: 257 VKYLGVLIDKNLTFKYHIEHITT 279 >SB_207| Best HMM Match : RVT_1 (HMM E-Value=7.4e-06) Length = 773 Score = 29.1 bits (62), Expect = 4.5 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = -3 Query: 678 RSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKS-LQVIQSRFCRI 532 R+ + + + Y TCIRP YA +F ++ L + L+ Q R RI Sbjct: 677 RAHVKPKELILFYLTCIRPCTEYACALFHNSLTKYLAADLESCQKRVLRI 726 >SB_36728| Best HMM Match : ArsD (HMM E-Value=1.6) Length = 364 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/53 (20%), Positives = 27/53 (50%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 544 R+ ++C R + + K+ +YK I P ++Y + + +++ L+ + R Sbjct: 304 RIGVLMCLRKLIPVTAKLRIYKAAILPHLSYCGLTWHFCRKSDSNKLERVNER 356 >SB_36411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 654 Score = 28.7 bits (61), Expect = 6.0 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -2 Query: 286 HHKHRSPSSSNPSLATKGSTSELTHRHSP-LSFSP 185 HH+H SPSS +PS + H H P LS SP Sbjct: 605 HHRH-SPSSPSPSCIAIITVIHYRHNHHPALSSSP 638 >SB_28982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1287 Score = 28.7 bits (61), Expect = 6.0 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = -3 Query: 678 RSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKS-LQVIQSRFCRI 532 R+ + + + Y TCIRP YA +F ++ L + L+ Q R RI Sbjct: 670 RAHVKPKELILFYLTCIRPCTEYACALFHNSLTKYLAADLESCQKRALRI 719 >SB_6579| Best HMM Match : RVT_1 (HMM E-Value=2.5e-14) Length = 952 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/54 (33%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -3 Query: 702 RLYPML-CSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSR 544 RLY + RS ++ + +Y IRP+M YA VFA + +L+ +Q R Sbjct: 808 RLYALRKLKRSGVADSEIMQVYCRLIRPIMEYACTVFADLPQYLSHALERVQKR 861 >SB_59269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1008 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 379 HTRPSRPNGKPSTSPKARHYGSS 311 HTRP+R G+P+T P H+ S Sbjct: 502 HTRPTRTVGRPATLPPQSHHHRS 524 >SB_53402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 28.7 bits (61), Expect = 6.0 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 5/45 (11%) Frame = +1 Query: 322 NDVLWATSTVYHSVYWVG-----YVITSGYDERVLMSCRLLKMAQ 441 NDVL +YH VYW G + S ++E V SC K+ + Sbjct: 22 NDVLAQRLLIYHPVYWGGRTSLSLAVASRHEEFVAHSCCQKKLTE 66 >SB_42893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 950 Score = 28.7 bits (61), Expect = 6.0 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = -3 Query: 702 RLYPMLCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCR 535 +L + KL++ K+T+Y+ CI + Y S + AR K L R R Sbjct: 597 KLSSRVWENKKLTISTKITVYRACILSTLLYGSESWTTYARQE-KRLNTFHMRCLR 651 >SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) Length = 210 Score = 28.7 bits (61), Expect = 6.0 Identities = 27/107 (25%), Positives = 42/107 (39%), Gaps = 1/107 (0%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLE 478 K Y T +RP++ YA+ + T++ L+ +Q R + L DL Sbjct: 47 KERAYFTLVRPILEYAAPAWNPYTDTDVNRLEQVQKNAARFVTNTYDPYASTTKLVKDLS 106 Query: 477 LDSFSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRR 337 D+ + ++ F K N LI A +PD V R RR Sbjct: 107 WDTLEQRRLTSQAILFYK---FHNSLIYAK---LPDLVTRSTRSTRR 147 >SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) Length = 570 Score = 28.7 bits (61), Expect = 6.0 Identities = 27/107 (25%), Positives = 42/107 (39%), Gaps = 1/107 (0%) Frame = -3 Query: 654 KVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGA-PWFLRNVDLHDDLE 478 K Y T +RP++ YA+ + T++ L+ +Q R + L DL Sbjct: 407 KERAYFTLVRPILEYAAPAWNPYTDTDVNRLEQVQKNAARFVTNTYDPYASTTKLVKDLS 466 Query: 477 LDSFSKYLQSASLRHFEKAARHENPLIVAAGNYIPDPVDRMVNRRRR 337 D+ + ++ F K N LI A +PD V R RR Sbjct: 467 WDTLEQRRLTSQAILFYK---FHNSLIYAK---LPDLVTRSTRSTRR 507 >SB_39569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -3 Query: 657 NKVTLYKTCIRPVMTYASVVFAHAARTNLKS 565 N+ YK CIR + YA VF +A LK+ Sbjct: 646 NRTLFYKACIRSAVDYAVPVFHNALPQYLKN 676 >SB_36917| Best HMM Match : RinB (HMM E-Value=2.2) Length = 522 Score = 28.3 bits (60), Expect = 7.9 Identities = 17/64 (26%), Positives = 28/64 (43%) Frame = -2 Query: 370 PSRPNGKPSTSPKARHYGSS*SINGAFRHHKHRSPSSSNPSLATKGSTSELTHRHSPLSF 191 P P+G+P + + + + + HHK+ +S L T +S R SPL+ Sbjct: 92 PRPPSGRPQSRRRKKSATNELRVRRKSSHHKYTEDASRLTGLPTHRISS--YKRDSPLAL 149 Query: 190 SPDL 179 P L Sbjct: 150 QPSL 153 >SB_48079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = -3 Query: 687 LCSRSKLSLRNKVTLYKTCIRPVMTYASVVFAHAARTNLKSLQVIQSRFCRIAVGAPW 514 +C+ K+ R K+ LYK + V+ Y + + + K L V Q + R + W Sbjct: 213 ICNSKKIMRRTKIKLYKPLVLSVLLYGCETWKMNKKDD-KLLDVFQQKCLRRILKISW 269 >SB_41542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 7.9 Identities = 9/18 (50%), Positives = 14/18 (77%) Frame = +3 Query: 180 RSGEKLSGLCLWVSSLVE 233 R+G + G+CLWV S++E Sbjct: 12 RNGSSVPGMCLWVVSIIE 29 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,055,689 Number of Sequences: 59808 Number of extensions: 520099 Number of successful extensions: 1947 Number of sequences better than 10.0: 209 Number of HSP's better than 10.0 without gapping: 1733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1940 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2287608719 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -