BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_A13 (792 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38878| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_45040| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 >SB_38878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 30.3 bits (65), Expect = 1.9 Identities = 16/48 (33%), Positives = 18/48 (37%) Frame = +1 Query: 565 EHHGEHGAGRQRVCRGXSPERNLEHCHASXHLXXGPXFXPHWKDPLXP 708 E +G H A R R R SP+ C F H DPL P Sbjct: 354 EMNGRHAAPRHRKIRCQSPQEPSIRCEPIKRTLLNEAFVQHKPDPLDP 401 >SB_45040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 28.3 bits (60), Expect = 7.5 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +1 Query: 574 GEHGAGRQRVCRGXSPERNLEHCHASXH 657 G+ GR RVC +P R EHC H Sbjct: 49 GQGVRGRTRVCNNPAPGRLGEHCAGKDH 76 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,305,431 Number of Sequences: 59808 Number of extensions: 168005 Number of successful extensions: 331 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 273 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 331 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2179815638 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -