BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_A12 (798 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 24 4.7 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 24 4.7 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 24 4.7 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 24.2 bits (50), Expect = 4.7 Identities = 15/69 (21%), Positives = 36/69 (52%), Gaps = 3/69 (4%) Frame = -3 Query: 574 VGASEATLLNMLNISPFS-YGLVVKQVYDSGT--IFAPEILDIKPEDLRAKFQAGVANVA 404 VG +E+ +++N+ F+ Y + + +Y +G + + +KPED+ +A + Sbjct: 261 VGVTESA--DLINLEKFAQYAVAIAAMYKTGLGKLSEKATVKVKPEDVPLNLRAHDVSTH 318 Query: 403 ALSLAIGYP 377 +++L+ P Sbjct: 319 SMTLSWAPP 327 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 24.2 bits (50), Expect = 4.7 Identities = 19/76 (25%), Positives = 30/76 (39%), Gaps = 2/76 (2%) Frame = -2 Query: 755 SQAPARPGAIAPLSVV-IPAHNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHI-LKPG 582 SQ+P + + +PA T TS A S PT+ + I+ +HI +P Sbjct: 22 SQSPTSTTTVTMATASPVPACTTTTSTTSTSGASAASSPTRDEMSVVVPISPLHIKQEPL 81 Query: 581 DQGWSF*SHPSQHVEH 534 + P H +H Sbjct: 82 GSDGPMPAQPPHHHQH 97 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 24.2 bits (50), Expect = 4.7 Identities = 19/76 (25%), Positives = 30/76 (39%), Gaps = 2/76 (2%) Frame = -2 Query: 755 SQAPARPGAIAPLSVV-IPAHNTGLGPEKTSFFQALSIPTKISKGTIEIINDVHI-LKPG 582 SQ+P + + +PA T TS A S PT+ + I+ +HI +P Sbjct: 22 SQSPTSTTTVTMATASPVPACTTTTSTTSTSGASAASSPTRDEMSVVVPISPLHIKQEPL 81 Query: 581 DQGWSF*SHPSQHVEH 534 + P H +H Sbjct: 82 GSDGPMPAQPPHHHQH 97 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 726,169 Number of Sequences: 2352 Number of extensions: 13328 Number of successful extensions: 27 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -