BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_A10 (804 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPACUNK4.14 |mdb1||BRCT domain protein|Schizosaccharomyces pombe... 26 5.5 SPAC57A7.05 |||conserved protein |Schizosaccharomyces pombe|chr ... 26 7.2 SPBC119.17 ||SPBC577.01|metallopeptidase|Schizosaccharomyces pom... 25 9.5 SPAC2C4.14c |ppk11||PAK-related kinase Ppk11|Schizosaccharomyces... 25 9.5 SPBC1773.10c |||asparagine-tRNA ligase Ded81 |Schizosaccharomyce... 25 9.5 >SPACUNK4.14 |mdb1||BRCT domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 520 Score = 26.2 bits (55), Expect = 5.5 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = +3 Query: 54 LSLNRSQHDAALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR 209 ++L + + S +E ST+YS P E PD + + V+ KN+ Sbjct: 230 IALKEKESTSQDESNREAEEAPISTNYSFPSSSLEDQPDKNVQSSAVENKNK 281 >SPAC57A7.05 |||conserved protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 1337 Score = 25.8 bits (54), Expect = 7.2 Identities = 25/82 (30%), Positives = 35/82 (42%) Frame = +3 Query: 39 SPGAGLSLNRSQHDAALPSTTPRQERKSSTDYSEPRHRTELYPDLRSRDARVKKKNR*HR 218 S + S SQH L P E+KS D S PR + P S+ + +K+K R + Sbjct: 134 SSSSSSSSQSSQHSTHLQFQIPSNEKKSLDDPS-PRRK----PSFFSK-SNLKRKYRYLK 187 Query: 219 SPRSKWASTSRLAF*MRNATSK 284 +P W L F +N K Sbjct: 188 NP-DAWNLPPSLQFIPKNLNRK 208 >SPBC119.17 ||SPBC577.01|metallopeptidase|Schizosaccharomyces pombe|chr 2|||Manual Length = 992 Score = 25.4 bits (53), Expect = 9.5 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 2/52 (3%) Frame = -2 Query: 488 CDSNTAQYERNRSFGHLVHALGRAAGGAKLPSAGLCLNA--SKAEASLAESG 339 CD+ + S G L H + R GG + + + N+ SK E +A SG Sbjct: 601 CDACLNLGTHSESIGDLEHQIRRYTGGISISPSAVTNNSDVSKYELGIAISG 652 >SPAC2C4.14c |ppk11||PAK-related kinase Ppk11|Schizosaccharomyces pombe|chr 1|||Manual Length = 312 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 Query: 127 VDDFRSWRGVVLGRAASCCDLLRLS 53 VD FR W + SC DLL+LS Sbjct: 72 VDGFRLWITMEYCDGGSCLDLLKLS 96 >SPBC1773.10c |||asparagine-tRNA ligase Ded81 |Schizosaccharomyces pombe|chr 2|||Manual Length = 568 Score = 25.4 bits (53), Expect = 9.5 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = -2 Query: 416 AGGAKLPSAGLCLNASKAEASLAESGKDMLTVEPRESGGSKQ 291 A A+ +A A +AEA E+ K+++ EP+++ +K+ Sbjct: 89 AAEAEAAAAARAAAAKEAEAKRLEAAKNIVLKEPKDAPAAKK 130 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,234,605 Number of Sequences: 5004 Number of extensions: 66839 Number of successful extensions: 164 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 164 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 390427050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -