BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_A09 (766 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) 182 2e-46 SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) 36 0.036 SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.58 SB_57493| Best HMM Match : Surf_Ag_VNR (HMM E-Value=0.00037) 31 1.3 SB_49472| Best HMM Match : BDS_I_II (HMM E-Value=1.5) 30 2.3 SB_99| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_726| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_4542| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_58902| Best HMM Match : TNFR_c6 (HMM E-Value=0.032) 29 4.1 SB_54185| Best HMM Match : Gal_Lectin (HMM E-Value=2.3) 29 4.1 SB_8061| Best HMM Match : Homeobox (HMM E-Value=5.1e-27) 29 4.1 SB_43606| Best HMM Match : Y_phosphatase (HMM E-Value=3.9e-26) 29 4.1 SB_51220| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_49599| Best HMM Match : DDE (HMM E-Value=3.7e-20) 28 7.2 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 28 7.2 SB_13671| Best HMM Match : RVT_1 (HMM E-Value=1.8e-11) 28 9.5 SB_4520| Best HMM Match : Tsg (HMM E-Value=7.8) 28 9.5 >SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) Length = 328 Score = 182 bits (444), Expect = 2e-46 Identities = 83/109 (76%), Positives = 92/109 (84%) Frame = -2 Query: 696 GXTXIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQDHQPITEASYVNIPVIALCNTDSPL 517 G T IAGRFTPG FTNQIQAAFREPRLLIV DP DHQP+TEASYVNIPVIA CNTDSPL Sbjct: 95 GATPIAGRFTPGTFTNQIQAAFREPRLLIVCDPRIDHQPVTEASYVNIPVIAFCNTDSPL 154 Query: 516 RFVDIAIPCNTKSSHSIGLMWWLLAREVLRLRGVLPRDQRWDVVVDLFF 370 R VD+AIPCN K HSIGLM+WLLAREVLR+RG + R W+++ DL+F Sbjct: 155 RHVDVAIPCNNKGIHSIGLMFWLLAREVLRMRGSISRALPWEIMPDLYF 203 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = -1 Query: 760 VFVISSRPFGQRAVLKFAAHTRXYAYCGTF 671 V VIS+RP+GQRA+LK+A+HT G F Sbjct: 74 VCVISARPYGQRAILKYASHTGATPIAGRF 103 >SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1772 Score = 35.9 bits (79), Expect = 0.036 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Frame = +2 Query: 377 KSTTTSQRWSRGSTPRSLNTSRANNHHIKPIEWEDLVLHGIAMST-NLSGE---SVLHKA 544 K+TT RWS+G TP ++ H I L+ HG ST NL+ E VL++ Sbjct: 1396 KTTTDKTRWSKGQTPNGKVAQKSKFQH--GIAGTQLIYHGTGPSTKNLTTEQAKQVLNEN 1453 Query: 545 ITGMLTY 565 G +TY Sbjct: 1454 ELGTMTY 1460 >SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 31.9 bits (69), Expect = 0.58 Identities = 20/63 (31%), Positives = 29/63 (46%) Frame = -1 Query: 682 CGTFHTRCFY*PDPSCIP*TSSLDCIGPCTRPSTHY*SFICQHSCDCFVQHRLPTKICGH 503 C H+ C SCI S+ DCI C+ PS F C+ +C T++C + Sbjct: 866 CKKCHSSC-----SSCIG-PSANDCI-TCSDPSNALIGFTCKANCTPGQFKNTATRVCEN 918 Query: 502 CYP 494 C+P Sbjct: 919 CHP 921 >SB_57493| Best HMM Match : Surf_Ag_VNR (HMM E-Value=0.00037) Length = 432 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = -2 Query: 606 LDPAQDHQPITEASYVNIPVIALCNTDSPLRF 511 LDP +HQPIT+ + I ++A TD+PL+F Sbjct: 119 LDPDVEHQPITDRAEACICLVA---TDAPLKF 147 >SB_49472| Best HMM Match : BDS_I_II (HMM E-Value=1.5) Length = 315 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -2 Query: 474 HSIGLMWWLLAREVLRLRGVLP 409 H G +WW+L E LR + VLP Sbjct: 46 HDDGSVWWVLTSESLRAKAVLP 67 >SB_99| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 29.9 bits (64), Expect = 2.3 Identities = 20/62 (32%), Positives = 29/62 (46%) Frame = +1 Query: 532 VAQSNHRNVDI*SFSNGLMVLCRVQYNQETRFTECSLDLVSKSTWCETSRNXRXTGCARQ 711 V SN +V + N + CR Q NQ T FT + ++ C+T RN R + + Sbjct: 876 VYNSNKGSVRVHPSDNSGSLNCRKQTNQTTAFTWPGVVNLTWKRGCQTMRNMRSSTRSAV 935 Query: 712 TS 717 TS Sbjct: 936 TS 937 >SB_726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 29.5 bits (63), Expect = 3.1 Identities = 17/67 (25%), Positives = 29/67 (43%), Gaps = 3/67 (4%) Frame = +2 Query: 362 HG*KNKSTTTSQRWSRGSTPRSLNTSRANNHHIKPIEWEDL---VLHGIAMSTNLSGESV 532 H N+ T ++ STP + N+ ++P EW ++ H + L+GES Sbjct: 2 HRGSNRRPTFKYKFGDSSTPFYSALKKQNDRSMRPWEWHEMKARYSHAQTLINALTGESK 61 Query: 533 LHKAITG 553 +TG Sbjct: 62 YEFTLTG 68 >SB_4542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 987 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -3 Query: 197 SCFWSTPCSRRMVCPGTR*VEHNCRRTSRRHRSA 96 +C W+ P R+ PG R H T+R H +A Sbjct: 904 TCSWALPAHYRVHVPGQRSASHEAFDTTRPHENA 937 >SB_58902| Best HMM Match : TNFR_c6 (HMM E-Value=0.032) Length = 397 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -1 Query: 625 TSSLDCIGPCTRPSTHY*SFICQHSCDCFVQHRLPTKICGHC 500 TSSLD + PC+ S H+ + + C C+ +++ C C Sbjct: 331 TSSLDTLAPCSF-SCHFACDVNTNQCICYYGYQMSDNKCKAC 371 >SB_54185| Best HMM Match : Gal_Lectin (HMM E-Value=2.3) Length = 225 Score = 29.1 bits (62), Expect = 4.1 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 532 VAQSNHRNVDI*SFSNGLMVLCRVQYNQETRFTECSLDLVSKSTWCETSRNXR 690 V SN +V + N + CR Q NQ T FT + ++ C+T RN R Sbjct: 155 VYNSNKGSVRVHPSDNSGSLNCRKQTNQTTAFTWPGVVNLTWKRGCQTMRNMR 207 >SB_8061| Best HMM Match : Homeobox (HMM E-Value=5.1e-27) Length = 418 Score = 29.1 bits (62), Expect = 4.1 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +3 Query: 372 RTNQPQHPSAGHGEA-HHEASTLHVPTTTTSNQ*SGKTWCC 491 R QP H ++ + A HH A LH P +TS + W C Sbjct: 176 RDGQPCHGASMNNFAYHHAADFLHYPPVSTSYMPAHPYWTC 216 >SB_43606| Best HMM Match : Y_phosphatase (HMM E-Value=3.9e-26) Length = 280 Score = 29.1 bits (62), Expect = 4.1 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = +1 Query: 532 VAQSNHRNVDI*SFSNGLMVLCRVQYNQETRFTECSLDLVSKSTWCETSRNXR 690 V SN +V + N + CR Q NQ T FT + ++ C+T RN R Sbjct: 196 VYNSNKGSVRVHPSDNSGSLNCRKQTNQTTAFTWPGVVNLTWKRGCQTMRNMR 248 >SB_51220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1601 Score = 28.7 bits (61), Expect = 5.4 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 416 TPRSLNTSRANNHHIKPIEWEDLVLHGIAMSTNLSGESVLH 538 T +SLN S N + P EW + V+ G+ LSG ++L+ Sbjct: 864 TAQSLNVSVDNLKFLAPTEWRE-VIPGLKQEILLSGSNMLN 903 >SB_49599| Best HMM Match : DDE (HMM E-Value=3.7e-20) Length = 428 Score = 28.3 bits (60), Expect = 7.2 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = -2 Query: 630 REPR-LLIVLDPAQDHQPITEASYVNIPVIALC-NTDSPLRFVDIAIPCNTK 481 RE R +++ +D A H P + +Y NI +I L NT S + +D I N K Sbjct: 255 RENRNIMLFMDNAPCHTPSLKNTYCNIKIIFLSKNTTSKTQPLDSGIIANWK 306 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 28.3 bits (60), Expect = 7.2 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +1 Query: 361 SRLEEQINHNIPALVTGKHTTKPQHFTCQQPPHQTNRVGR-LGVAWDSNVHK 513 S + Q+ + P +T HT+ T P HQ + +GR G DSNV + Sbjct: 240 SSVTNQMRGHEPRSITYNHTSITAPLTTGYPDHQGSYMGRYAGSVADSNVSR 291 >SB_13671| Best HMM Match : RVT_1 (HMM E-Value=1.8e-11) Length = 1702 Score = 27.9 bits (59), Expect = 9.5 Identities = 17/44 (38%), Positives = 26/44 (59%) Frame = -2 Query: 528 DSPLRFVDIAIPCNTKSSHSIGLMWWLLAREVLRLRGVLPRDQR 397 +SPL + I +PCNT +S+ W+LLA + ++ VL D R Sbjct: 495 ESPLSYDLILVPCNTPNSNH----WFLLA-VLPHMKAVLLLDSR 533 >SB_4520| Best HMM Match : Tsg (HMM E-Value=7.8) Length = 594 Score = 27.9 bits (59), Expect = 9.5 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Frame = +2 Query: 398 RWSRGSTPRSLNTSRA---NNHHIKPIEWE-DLVLHGIAMSTNLSGESVLH 538 RWS +TPR TS N H+ P+ + D+ H A + +L S ++ Sbjct: 62 RWSHATTPRGGGTSSVLALNLAHVPPVSGDYDVAFHKHAAAVHLEDWSTIN 112 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,949,754 Number of Sequences: 59808 Number of extensions: 474065 Number of successful extensions: 1080 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 965 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1076 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -