BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_A02 (805 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 24 1.6 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 24 1.6 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 23 2.8 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 23 2.8 S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subu... 21 8.7 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 622 WMLXLGWLVYGIGDLMI 672 W+ L W YG G LMI Sbjct: 587 WLSFLSWFRYGNGALMI 603 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 23.8 bits (49), Expect = 1.6 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 622 WMLXLGWLVYGIGDLMI 672 W+ L W YG G LMI Sbjct: 587 WLSFLSWFRYGNGALMI 603 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +2 Query: 95 RKKHGEDLPTGGRSRRKGEKLE*MQREEQFCCP*EP 202 ++K +D GG S +K + ++ Q+C P P Sbjct: 557 KRKRKQDPADGGNSMKKCRARYGLDQQNQWCKPCRP 592 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +2 Query: 95 RKKHGEDLPTGGRSRRKGEKLE*MQREEQFCCP*EP 202 ++K +D GG S +K + ++ Q+C P P Sbjct: 449 KRKRKQDPADGGNSMKKCRARYGLDQQNQWCKPCRP 484 >S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subunit protein. Length = 141 Score = 21.4 bits (43), Expect = 8.7 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 528 PSSLGMXKGVSPPYFQVNDESQASRLIS 445 P+S+G+ VS P F+V Q + IS Sbjct: 21 PNSVGVSNEVSLPQFKVLGHRQRAMEIS 48 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,166 Number of Sequences: 336 Number of extensions: 3235 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21895259 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -