BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_T7_A01 (1182 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 27 1.4 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 26 1.9 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 26.6 bits (56), Expect = 1.4 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 93 GXTXGGXAGGGXXRGXGXXGGXXXRXRXRGXEGGXXRKGXG 215 G G GGG G G GG R R RG G G G Sbjct: 58 GGGDDGYGGGGRG-GRGGRGGGRGRGRGRGGRDGGGGFGGG 97 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 26.2 bits (55), Expect = 1.9 Identities = 14/47 (29%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = -3 Query: 229 GXLXXPXPXRSXPPSXPRXLXLXXXPPSXPXP-RXXPPPAXPPXVXP 92 G + P P PR + PP P P R PP P + P Sbjct: 196 GNVGPPRTGTPTQPQPPRPGGMYPQPPGVPMPMRPQMPPGAVPGMQP 242 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.314 0.133 0.389 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 342,350 Number of Sequences: 2352 Number of extensions: 2682 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 66 effective length of database: 408,747 effective search space used: 133660269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (22.0 bits)
- SilkBase 1999-2023 -