BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_P24 (909 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 26 1.4 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 25 4.2 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 26.2 bits (55), Expect = 1.4 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +1 Query: 205 YNHKGEVLISRVYRDDIGRNAVDAFRVNVIHARQQVRSPVTNIARTSFFHIKRAN 369 YNH E ++ V+ + IGRN + +N+ +A P+ + +KRAN Sbjct: 1710 YNHVAESILHAVHDEPIGRNYGNG--LNIGNAGHTGEIPLRPLVLDDSSILKRAN 1762 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 24.6 bits (51), Expect = 4.2 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 2/60 (3%) Frame = -1 Query: 393 LCDCCQPNICTLDM--EERCACNVGNR*SHLLASMDHIHSECVHSITTNIIPVDSRDQHL 220 LC CC+ + C +M CAC N S + S ++ N IP+D+ + ++ Sbjct: 779 LCHCCEFDACDCEMTCPNNCACYHDNSWSTNIVEC----SAAGYTDIPNNIPMDTTEVYI 834 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 943,542 Number of Sequences: 2352 Number of extensions: 21398 Number of successful extensions: 69 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 98401338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -