BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_P21 (883 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC11B10.02c |his3||histidinol-phosphate aminotransferase imida... 27 3.5 SPCC550.03c |||RNA helicase involved in mRNA catabolism|Schizosa... 27 4.7 SPAC1851.04c ||SPAC27D7.01c|guanyl-nucleotide exchange factor |S... 27 4.7 SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccha... 26 6.2 >SPBC11B10.02c |his3||histidinol-phosphate aminotransferase imidazole acetol phosphate transaminase His3|Schizosaccharomyces pombe|chr 2|||Manual Length = 384 Score = 27.1 bits (57), Expect = 3.5 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 21 INDIPIIKFLFSPTSSLNVSISMSTHSFPTRLKL 122 IND+ ++K L P +LNV T S + +K+ Sbjct: 124 INDVEVVKVLLEPDFNLNVDAICETLSKDSAIKV 157 >SPCC550.03c |||RNA helicase involved in mRNA catabolism|Schizosaccharomyces pombe|chr 3|||Manual Length = 1213 Score = 26.6 bits (56), Expect = 4.7 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +1 Query: 367 YDLSRFASSHLKPLQIHVCNDYSAFDQSQHGEAVVLERKKMERLSIPSHLIDLH 528 +D + SS+ + IH N++ S+H E L K +S+P ++LH Sbjct: 195 WDTKKVKSSNRNFVTIHELNEHLKNVNSKHSEIDDLLPDKRSIVSLPPSTLNLH 248 >SPAC1851.04c ||SPAC27D7.01c|guanyl-nucleotide exchange factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 1052 Score = 26.6 bits (56), Expect = 4.7 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +3 Query: 96 HSFPTRLKLSSKRTQIVRIP 155 H P R++LSS+ QI RIP Sbjct: 5 HGTPQRIQLSSRAIQICRIP 24 >SPBC83.01 |ucp8||UBA/EH/EF hand domain protein Ucp8|Schizosaccharomyces pombe|chr 2|||Manual Length = 884 Score = 26.2 bits (55), Expect = 6.2 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -2 Query: 540 FDVAMEVYKMRWNGKPL-HFLPFQDN 466 F VAME+ K+R +GK L L + DN Sbjct: 358 FAVAMEIIKLRLSGKSLASILAYDDN 383 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,490,934 Number of Sequences: 5004 Number of extensions: 73372 Number of successful extensions: 221 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 216 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 221 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 442483990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -