BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_P21 (883 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 8.6 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 8.6 Identities = 23/79 (29%), Positives = 27/79 (34%), Gaps = 2/79 (2%) Frame = +1 Query: 430 YSAFDQSQHGEAVVLERKKMERLSIPSHLIDLHCYIKTNITSQFGPLTCMRLTGR--ARH 603 Y AF S LE+ L P+ L I T T+ T A Sbjct: 72 YPAFSSSCDPVPGNLEQIGSRPLHPPASSTSLPATITTTTTTTTTTTATAAATATTTATG 131 Query: 604 L*RQHGLQYCRHLQRVRHH 660 L +Q LQ HLQ HH Sbjct: 132 LIKQETLQRHHHLQNHHHH 150 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 239,150 Number of Sequences: 438 Number of extensions: 5122 Number of successful extensions: 11 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28644972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -