BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_P15 (883 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20960.1 68415.m02479 expressed protein pEARLI 4 gene product... 32 0.58 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 31 0.77 At1g30810.1 68414.m03767 transcription factor jumonji (jmj) fami... 31 1.0 At1g10620.1 68414.m01204 protein kinase family protein contains ... 31 1.0 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 31 1.3 At1g08170.1 68414.m00902 histone H2B family protein similar to h... 31 1.3 At3g24540.1 68416.m03082 protein kinase family protein contains ... 30 1.8 At5g06970.1 68418.m00789 expressed protein 30 2.4 At1g70895.1 68414.m08180 CLE17, putative CLAVATA3/ESR-Related 17... 30 2.4 At5g24570.1 68418.m02901 expressed protein 29 3.1 At2g41360.1 68415.m05105 F-box family protein similar to SKP1 in... 29 3.1 At4g27520.1 68417.m03952 plastocyanin-like domain-containing pro... 29 4.1 At3g60920.1 68416.m06815 beige/BEACH domain-containing protein c... 29 4.1 At2g31910.1 68415.m03898 cation/hydrogen exchanger, putative sim... 29 4.1 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 29 4.1 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 29 5.4 At5g38560.1 68418.m04662 protein kinase family protein contains ... 28 7.2 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 28 7.2 At3g14790.1 68416.m01869 NAD-dependent epimerase/dehydratase fam... 28 7.2 At3g11680.1 68416.m01432 expressed protein contains Pfam profile... 28 7.2 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 28 7.2 At2g07880.1 68415.m01007 hypothetical protein 28 7.2 At1g53500.1 68414.m06066 NAD-dependent epimerase/dehydratase fam... 28 7.2 At5g67070.1 68418.m08457 rapid alkalinization factor (RALF) fami... 28 9.5 At5g35910.1 68418.m04312 3'-5' exonuclease domain-containing pro... 28 9.5 At2g41210.1 68415.m05089 phosphatidylinositol-4-phosphate 5-kina... 28 9.5 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 28 9.5 At1g59453.1 68414.m06679 transcription factor-related weak simil... 28 9.5 >At2g20960.1 68415.m02479 expressed protein pEARLI 4 gene product [Arabidopsis thaliana] GI:871782 Length = 748 Score = 31.9 bits (69), Expect = 0.58 Identities = 29/104 (27%), Positives = 39/104 (37%) Frame = +3 Query: 300 PESRKAPPSPRYYSVCISTIYPGLRRPIWRSSPMTPPSTTRVGRRRCFIDDFRPQLPPWD 479 PE+R P RY + P P TP + R R I D RP+ P + Sbjct: 219 PETRPRTPDHRYATYDNRPRTPIHESAATERRPQTPETRPRTPEHRSAIPDTRPRTPIHE 278 Query: 480 SGSGSGASTLTPRKAQRCSSKGVALRTPR*ASLSRLGASITPPP 611 S + +G TP R + + R+P S S TP P Sbjct: 279 S-AATGRRPQTPETRPRTAQR--RGRSPEFMERSPGPRSKTPEP 319 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 31.5 bits (68), Expect = 0.77 Identities = 22/85 (25%), Positives = 36/85 (42%) Frame = +3 Query: 159 SGTTV*YTNCITWECQTGSCSSYETTCRTVRSDIESRERVPGPVTSQPESRKAPPSPRYY 338 +G + Y + W+C T S S + + I S P P P+ PP+P+ Sbjct: 49 TGHSFGYGDSKVWKC-TYSNGSAPAISISPSTPIPSTPSTPSPPPPAPKKSPPPPTPK-K 106 Query: 339 SVCISTIYPGLRRPIWRSSPMTPPS 413 S ++ P + P + SP PP+ Sbjct: 107 SPSPPSLTPFVPHPTPKKSPSPPPT 131 >At1g30810.1 68414.m03767 transcription factor jumonji (jmj) family protein / zinc finger (C5HC2 type) family protein contains similarity to Swiss-Prot:P29375 retinoblastoma-binding protein 2 (RBBP-2) [Homo sapiens]; contains Pfam domains PF02375: jmjN domain and PF02373: jmjC domain; intron between exons 6 and 7 was required to circumvent a frameshift. There could be an underlying sequence error. Length = 787 Score = 31.1 bits (67), Expect = 1.0 Identities = 17/77 (22%), Positives = 31/77 (40%) Frame = +3 Query: 246 VRSDIESRERVPGPVTSQPESRKAPPSPRYYSVCISTIYPGLRRPIWRSSPMTPPSTTRV 425 ++ D+ + P + + P SPR+ V + +RPI +P+ PS Sbjct: 10 IKEDMSLKNHPPDKDKDKDTIMEQPSSPRHRKVVARWLPDEAQRPIINDAPVFTPSLEEF 69 Query: 426 GRRRCFIDDFRPQLPPW 476 +I+ RP P+ Sbjct: 70 VDPLAYIEKIRPLAEPY 86 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 31.1 bits (67), Expect = 1.0 Identities = 20/63 (31%), Positives = 27/63 (42%) Frame = +3 Query: 285 PVTSQPESRKAPPSPRYYSVCISTIYPGLRRPIWRSSPMTPPSTTRVGRRRCFIDDFRPQ 464 P +QP + PP+P S+ P + P P PP +T G I +PQ Sbjct: 68 PPPNQPPNTTPPPTPP------SSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQ 121 Query: 465 LPP 473 LPP Sbjct: 122 LPP 124 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 30.7 bits (66), Expect = 1.3 Identities = 36/121 (29%), Positives = 45/121 (37%), Gaps = 9/121 (7%) Frame = +3 Query: 279 PGPVTSQPESRKAPPSPRYYSVCISTIYPGLRRPIWRSSPMTPPSTTRVGRRRCFIDDFR 458 P P + S APP P + G +R P PP TR+ +C Sbjct: 605 PPPSSRSIPSPSAPPPPPPPPPSFGST--GNKRQAQPPPPPPPPPPTRIPAAKCAPP--- 659 Query: 459 PQLPPWDSGSGS---GASTLTPR------KAQRCSSKGVALRTPR*ASLSRLGASITPPP 611 P PP S SGS G + P KA ++ P S +RLGA PPP Sbjct: 660 PPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPP 719 Query: 612 P 614 P Sbjct: 720 P 720 >At1g08170.1 68414.m00902 histone H2B family protein similar to histone H2B from Chlamydomonas reinhardtii [SP|P54347, SP|P54346, SP|P50565], Volvox carteri [SP|P16867, SP|P16868]; contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4 Length = 243 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 560 TTLSIPLPTRRVNNPAPAVRPITMYDQPIPWAPK 661 TT+ IP+ R ++P P P+ + D+P P P+ Sbjct: 79 TTVKIPVDDRDESSPQPPETPVEVRDEPSPQPPE 112 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 30.3 bits (65), Expect = 1.8 Identities = 20/64 (31%), Positives = 30/64 (46%) Frame = +3 Query: 585 LGASITPPPPFAQSRCTTSPYRGPRRSNI*ASPSTVG*HSAPTSRRYAIVPPSS*DVSTR 764 + S++PPPP +T P G R ASPS + + +++ PPS +ST Sbjct: 65 VNVSLSPPPPPRSPSTSTPPRLGNRNPPPPASPSGQEPTTPTMTPGFSLSPPSPSRLSTG 124 Query: 765 *YVG 776 VG Sbjct: 125 AVVG 128 >At5g06970.1 68418.m00789 expressed protein Length = 1101 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = +3 Query: 300 PESRKAPP--SPRYYSVCISTIYPGLRRPIWRSSPMTPP 410 PES +PP +P V IS+ P + P W SP PP Sbjct: 98 PESSGSPPKRAPPPIPVLISSSSPMVTNPEWCESPSAPP 136 >At1g70895.1 68414.m08180 CLE17, putative CLAVATA3/ESR-Related 17 (CLE17) Length = 99 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +3 Query: 585 LGASITPPPPFAQSRCTTSPYRGP 656 L AS PPPP R +T+P+RGP Sbjct: 53 LVASPPPPPPRKALRYSTAPFRGP 76 >At5g24570.1 68418.m02901 expressed protein Length = 70 Score = 29.5 bits (63), Expect = 3.1 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 570 ASLSRLGASITPPPPFAQSRCTTSPYRGPRRSNI 671 A+L+R+ A++ PPPP + R +P G S++ Sbjct: 16 AALTRITATLLPPPPTSHRRSVRAPTSGRADSSL 49 >At2g41360.1 68415.m05105 F-box family protein similar to SKP1 interacting partner 6 [Arabidopsis thaliana] GI:10716957; contains Pfam profile PF00646: F-box domain Length = 373 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -3 Query: 182 CISNRCARLYRTPSLYRRRGLL 117 C+S R L RTP LYR R LL Sbjct: 36 CVSVRLRSLVRTPELYRMRSLL 57 >At4g27520.1 68417.m03952 plastocyanin-like domain-containing protein similar to PIR|JC7196 phytocyanin-related protein Pn14 {Ipomoea nil}; contains Pfam profile PF02298: Plastocyanin-like domain Length = 349 Score = 29.1 bits (62), Expect = 4.1 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +2 Query: 539 KRGRPPNTTLSIPLPTRRVNNPAPAVRPITMYDQPIPWAPK 661 K G P + T S P P + + +P+ P+T P P APK Sbjct: 206 KSGSPVSPTTSPPAPPKSTSPVSPSSAPMT--SPPAPMAPK 244 >At3g60920.1 68416.m06815 beige/BEACH domain-containing protein contains Pfam PF02138: Beige/BEACH domain; similar to LBA isoform gamma (GI:10257405) [Mus musculus]; similar to beige-like protein (CDC4L) - Homo sapiens; similar to Neurobeachin: kinase A-anchoring, beige/Chediak-higashi protein homolog implicated in neuronal membrane traffic (AKAP550) (GI:11863541) [Drosophila melanogaster]. Length = 1928 Score = 29.1 bits (62), Expect = 4.1 Identities = 26/87 (29%), Positives = 40/87 (45%), Gaps = 6/87 (6%) Frame = -1 Query: 580 ERDAQRGVRRATPFEEHRCAFRGVNVDAPLPEPLSHGGSCGLK--SSMKQRLL----PTR 419 ER + RR+ E+ G+N PL E S +K S +K+R++ T Sbjct: 1485 ERKGENEERRSGSLEDAITLSTGINDHRPLSEQNMVQNSTEVKDLSELKERIVLEISSTM 1544 Query: 418 VVDGGVIGEERQMGLRRPGYIVDIQTE 338 V GV+ Q+ RR +IVDI+ + Sbjct: 1545 VRPLGVVKGTFQITTRRINFIVDIRED 1571 >At2g31910.1 68415.m03898 cation/hydrogen exchanger, putative similar to monovalent cation:proton antiporter family 2 (CPA2) members (see PMID:11500563 for other members) Length = 735 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -2 Query: 633 YIVIGRTAGAGLLTRLVGRGMLSVVFGGRPLLKSTAVLFVGL 508 YI+ G A G + R V GM++VV ++K + +F + Sbjct: 232 YIICGLRADIGYMNRTVSVGMMAVVTSASVMVKILSTMFCSI 273 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 29.1 bits (62), Expect = 4.1 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +3 Query: 279 PGPVTSQPESRKAPPSPRY-YSVCISTIYPGLRRPIWRSSPMTPPST 416 P PV + P + ++PP P+Y + YP P ++ + PP T Sbjct: 565 PPPVVNCPPTTQSPPPPKYEQTPSPREYYPSPSPPYYQYTSSPPPPT 611 Score = 28.7 bits (61), Expect = 5.4 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +3 Query: 279 PGPVTSQPESRKAPPSPRYYSVCISTIYPG--LRRPIWRSSPMTPP 410 P PV P + PP P YY+ I + P P+ +S P PP Sbjct: 635 PPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPP 680 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 28.7 bits (61), Expect = 5.4 Identities = 35/119 (29%), Positives = 46/119 (38%), Gaps = 7/119 (5%) Frame = +1 Query: 34 RQTLVRPSSAPPHGAHLTRAEQAETH----SDRSPLLRYS-EGVR*SLAQRFDIQTV*HG 198 R L RP G +R++Q H S RS R + S + R Sbjct: 467 RARLSRPLQKAGKGRQSSRSDQRSRHGAGRSGRSSFARLPPRSLASSRSARGAGSRAPSS 526 Query: 199 SARQARAHHTRLLVEPFVPISSRGNAFPAPSRHSRSP--ARLRPLPVTIQFVYQRYTPV 369 SA++A R P +P +R P P+R P AR RPLP + Y R PV Sbjct: 527 SAKRASGSRGRR-PRPPLPPPARARPLPPPARARPMPPPARARPLPPPAR-SYDRRPPV 583 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 28.3 bits (60), Expect = 7.2 Identities = 43/155 (27%), Positives = 55/155 (35%) Frame = +3 Query: 279 PGPVTSQPESRKAPPSPRYYSVCISTIYPGLRRPIWRSSPMTPPSTTRVGRRRCFIDDFR 458 P V+S P S PPSP + T+ P+ +SP PPST Sbjct: 58 PPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASP--PPSTPAT-TPPAPPQTVS 114 Query: 459 PQLPPWDSGSGSGASTLTPRKAQRCSSKGVALRTPR*ASLSRLGASITPPPPFAQSRCTT 638 P PP S S +T P S G TP S G + +PP P + T Sbjct: 115 PPPPPDASPSPPAPTTTNPPPKPSPSPPG---ETP-----SPPGETPSPPKPSPSTPTPT 166 Query: 639 SPYRGPRRSNI*ASPSTVG*HSAPTSRRYAIVPPS 743 + P ASP + S PT PP+ Sbjct: 167 TTTSPPPPPATSASPPS----SNPTDPSTLAPPPT 197 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 28.3 bits (60), Expect = 7.2 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +2 Query: 551 PPNTTLSIPLPTRRVNNPAPAVRP-ITMYDQPIPWAP 658 PP T S+P PT V+ P P P + P+P P Sbjct: 137 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDP 173 >At3g14790.1 68416.m01869 NAD-dependent epimerase/dehydratase family protein similar to dTDP-glucose 4,6-dehydratase from Aneurinibacillus thermoaerophilus GI:16357461, Saccharopolyspora spinosa GI:15077647, RmlB from Leptospira borgpetersenii GI:4234803; contains Pfam profile PF01370 NAD dependent epimerase/dehydratase family Length = 664 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/37 (35%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +2 Query: 134 DIAKAFDKVWHNGLIYKLYNMGVP-DRLVLIIRDYLS 241 D+A+AF+ V H G + +YN+G +R V+ + + +S Sbjct: 230 DVAEAFEVVLHKGEVNHVYNIGTTRERRVIDVANDIS 266 >At3g11680.1 68416.m01432 expressed protein contains Pfam profile PF01027: Uncharacterized protein family UPF0005 Length = 488 Score = 28.3 bits (60), Expect = 7.2 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 3/52 (5%) Frame = -2 Query: 699 VILLSRVTPKYLTFGAHGMGW---SYIVIGRTAGAGLLTRLVGRGMLSVVFG 553 V LL V P Y++FG GM W + +V+ G L++ + RG +++ G Sbjct: 58 VSLLYYVRPLYISFGVTGM-WAILTVVVVFEFTVGGTLSKGLNRGFATLIAG 108 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 28.3 bits (60), Expect = 7.2 Identities = 20/62 (32%), Positives = 29/62 (46%), Gaps = 5/62 (8%) Frame = +2 Query: 548 RPPNTTLSIPLPTRRVNNP----APAVRPITMYDQPIP-WAPKVKYLGVTLDSRMTFRPH 712 +PP T S P+ V P +P V+P ++ P P ++P VK V T+ P Sbjct: 410 KPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPP 469 Query: 713 IK 718 IK Sbjct: 470 IK 471 >At2g07880.1 68415.m01007 hypothetical protein Length = 173 Score = 28.3 bits (60), Expect = 7.2 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 2/42 (4%) Frame = +2 Query: 533 LFKRGRPP--NTTLSIPLPTRRVNNPAPAVRPITMYDQPIPW 652 L++ GR P + T I LP RV P P+ RPIT+ +P+ Sbjct: 75 LYQHGRVPPLSFTRPITLPPSRVL-PPPSTRPITLPHGRVPY 115 >At1g53500.1 68414.m06066 NAD-dependent epimerase/dehydratase family protein low similarity to dTDP-D-glucose-4,6-dehydratase from Aneurinibacillus thermoaerophilus GI:16357461, Sphingomonas sp. GI:1314581; contains Pfam profile PF01370: NAD dependent epimerase/dehydratase family; putative NDP-rhamnose synthase (rhm2 gene) GI:31559258 Length = 667 Score = 28.3 bits (60), Expect = 7.2 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = +2 Query: 134 DIAKAFDKVWHNGLIYKLYNMGV--PDRLVLIIRD 232 D+A+AF+ V H G I +YN+G R++ + RD Sbjct: 232 DVAEAFEVVLHKGEIGHVYNVGTKRERRVIDVARD 266 >At5g67070.1 68418.m08457 rapid alkalinization factor (RALF) family protein similar to RALF precursor [Nicotiana tabacum] GI:16566316 Length = 129 Score = 27.9 bits (59), Expect = 9.5 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -3 Query: 203 ALPCYTVCISNRCARLYRTPSLYRRRGLLSEWVSACSALVRC 78 AL V R R Y T + +R RG + + CS++ RC Sbjct: 86 ALSANRVPCPPRSGRSYYTHNCFRARGPVHPYSRGCSSITRC 127 >At5g35910.1 68418.m04312 3'-5' exonuclease domain-containing protein / helicase and RNase D C-terminal domain-containing protein / HRDC domain-containing protein low similarity to SP|Q01780 Polymyositis/scleroderma autoantigen 2 {Homo sapiens}; contains Pfam profiles PF00570: HRDC domain, PF01612: 3'-5' exonuclease Length = 838 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -1 Query: 616 NGGGGVIDAPSRERDAQRGVRRATPF 539 NGGG VID ERD + PF Sbjct: 133 NGGGSVIDVKMAERDKNSSGKAKVPF 158 >At2g41210.1 68415.m05089 phosphatidylinositol-4-phosphate 5-kinase family protein similar to phosphatidylinositol-4-phosphate 5-kinase AtPIP5K1 [Arabidopsis thaliana] GI:3702691; contains Pfam profiles PF01504: Phosphatidylinositol-4-phosphate 5-Kinase, PF02493: MORN repeat Length = 772 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 628 DVRPAHTVGPEGQIFRRHPRQ*DDIPPPHQ 717 D++P+ P+ +I+RR PR+ PPHQ Sbjct: 407 DLKPS-AFDPKDKIWRRFPREGTKYTPPHQ 435 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 27.9 bits (59), Expect = 9.5 Identities = 21/77 (27%), Positives = 31/77 (40%) Frame = +3 Query: 285 PVTSQPESRKAPPSPRYYSVCISTIYPGLRRPIWRSSPMTPPSTTRVGRRRCFIDDFRPQ 464 P +S P +PPS S S++ P P+ SP +PP + Sbjct: 29 PSSSSPSLSPSPPSSSPSSAPPSSLSPSSPPPL-SLSPSSPPPPPPSSSPLSSLSPSLSP 87 Query: 465 LPPWDSGSGSGASTLTP 515 PP S S + S+L+P Sbjct: 88 SPPSSSPSSAPPSSLSP 104 >At1g59453.1 68414.m06679 transcription factor-related weak similarity to TFIIIC Box B-binding subunit [Homo sapiens] GI:442362 Length = 1729 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 420 RVGRRRCFIDDFRPQLPPWDSGSGS 494 RV CF+ D+ LP WDS S S Sbjct: 649 RVKLLHCFLWDYFSSLPGWDSASSS 673 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,423,619 Number of Sequences: 28952 Number of extensions: 522015 Number of successful extensions: 1933 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 1564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1914 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2077687200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -