BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_P12 (871 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0456 + 29521282-29522064 32 0.69 06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586,890... 31 1.2 03_04_0006 + 16257288-16259522 30 2.8 06_03_0854 + 25400855-25403741,25406174-25407708 29 4.8 03_05_1067 - 30105850-30106034,30106036-30106192,30106301-30106399 29 4.8 01_06_1406 - 37073548-37073822,37073892-37074111,37074200-370742... 29 4.8 06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764 29 6.4 05_02_0081 + 6432957-6433289,6433367-6433882,6434283-6434570 29 6.4 02_05_1128 + 34314866-34315294,34315365-34315440,34315548-343156... 29 6.4 03_02_0740 - 10836752-10837052,10837756-10837814,10837901-108384... 28 8.5 >01_06_0456 + 29521282-29522064 Length = 260 Score = 31.9 bits (69), Expect = 0.69 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 6/47 (12%) Frame = -2 Query: 585 AWQC--PRTGSRGSFKRRRAFPPRHHSARLER----NTVRPPILSTA 463 AW+C P +G+RG +RRR P S R R +T+RP + S A Sbjct: 12 AWRCYSPASGARGGSRRRRRRPAGTTSRRCSRADRLDTLRPYVTSAA 58 >06_01_1087 + 8901950-8902102,8902960-8903996,8904438-8904586, 8905437-8905690,8905785-8908799,8908889-8909001, 8909975-8910164,8910399-8910512,8910591-8910698, 8910941-8911073,8911206-8911408,8911626-8911826 Length = 1889 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +3 Query: 189 GSQMPRHLISDAHEWINEIPTVPIYYLAKPQPRERAWENQRGKKTLLSL 335 G+ PR + D EW N PT+ ++ + +PRE Q+ K + L Sbjct: 1393 GNCAPRTVECDEGEWYNNFPTIDENHVQRNKPREEQIFQQKLKPAIFIL 1441 >03_04_0006 + 16257288-16259522 Length = 744 Score = 29.9 bits (64), Expect = 2.8 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = -2 Query: 396 AKRSP---TYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLDSR*GQWE 244 A+RSP Y T L + ARL T PA SP +AV S + G W+ Sbjct: 162 ARRSPWTVVYGTNLRTGETARLTPRGTFDLSPAVSPSGKRVAVASWQGKPGLWD 215 >06_03_0854 + 25400855-25403741,25406174-25407708 Length = 1473 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -2 Query: 396 AKRSPTYATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVS 271 AKR+PT T P AR +++ +F +P P P +V+S Sbjct: 475 AKRAPTAVTVGAPPPQARTPAAAPAKAF-VSAPAPAPSSVIS 515 >03_05_1067 - 30105850-30106034,30106036-30106192,30106301-30106399 Length = 146 Score = 29.1 bits (62), Expect = 4.8 Identities = 21/67 (31%), Positives = 30/67 (44%) Frame = +2 Query: 485 RTVFRSKRAEW*RGGNARRRLKLPRDPVRGHCQARSLTGAVHLSKNNAGVLRPAQRGQKP 664 R + +R E G +RR L D +RG+ + A H AG + RG KP Sbjct: 59 RCIAEGRREEEEEVGRSRRGKDLDLDDMRGYGET-----ATHHGLRLAGREEVSPRGGKP 113 Query: 665 RVEQKGK 685 RV+ G+ Sbjct: 114 RVDNGGR 120 >01_06_1406 - 37073548-37073822,37073892-37074111,37074200-37074246, 37074404-37074576,37075161-37075238,37075751-37075813, 37075889-37075961,37076150-37076189,37076302-37076368, 37076719-37078472,37079128-37079230,37080041-37080078, 37080221-37080347,37081944-37082152 Length = 1088 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 Query: 526 RKRSSPFKTPA*SGSRTLPGEEFDWGGTSV 615 +KR P K PA S S+ LPG + + G SV Sbjct: 339 KKRGRPRKYPAPSNSKHLPGTDTELGNDSV 368 >06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764 Length = 640 Score = 28.7 bits (61), Expect = 6.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 518 TTLHAWNETPCARRYY 471 TT AW ETPCA R++ Sbjct: 560 TTTEAWVETPCAHRFH 575 >05_02_0081 + 6432957-6433289,6433367-6433882,6434283-6434570 Length = 378 Score = 28.7 bits (61), Expect = 6.4 Identities = 16/45 (35%), Positives = 22/45 (48%) Frame = -3 Query: 698 DQASFCPFAPREVSVLAELALGHLRYSLTDVPPQSNSSPGSVLEP 564 D+A+ C R++ LA HLR L P S+SS + L P Sbjct: 56 DEAALCARCDRDIHAANRLAGKHLRLPLLS-PASSSSSSAAALAP 99 >02_05_1128 + 34314866-34315294,34315365-34315440,34315548-34315631, 34315729-34315784,34316302-34316358,34316459-34316508, 34316587-34316739,34316842-34316992,34317469-34317633 Length = 406 Score = 28.7 bits (61), Expect = 6.4 Identities = 18/60 (30%), Positives = 30/60 (50%), Gaps = 4/60 (6%) Frame = +2 Query: 542 RLKLPRDPVRGHCQARSLTGAVHLSKNNAGVLR----PAQRGQKPRVEQKGKSWLDPDVQ 709 R+ L R P++ + RS+ G + S+ +RG+KPR Q+G+ P+VQ Sbjct: 59 RVSLHRRPMKSPVERRSVVGTLGESRREHTTDLCGGGEERRGEKPRRRQRGERMPRPEVQ 118 >03_02_0740 - 10836752-10837052,10837756-10837814,10837901-10838476, 10839965-10841686,10841776-10842173,10842264-10842318, 10842989-10843048,10843444-10843540,10844885-10844955, 10845029-10845109,10846054-10846124,10847951-10848119, 10848521-10848683,10848752-10848942,10849037-10849168 Length = 1381 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 605 PPQSNSSPGSVLEPDHAGVLNGDE 534 P +NS P +V +PD +LNGDE Sbjct: 739 PTSNNSVPQNVDQPDSKKMLNGDE 762 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,054,138 Number of Sequences: 37544 Number of extensions: 527695 Number of successful extensions: 1575 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1518 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1573 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2444475072 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -