BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_P08 (858 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/n... 28 0.32 AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleo... 28 0.32 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 26 1.7 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 26 1.7 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 26 1.7 AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant r... 24 5.1 >AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 568 Score = 28.3 bits (60), Expect = 0.32 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 305 VTVQSLPNVSSIIKGYRDAYLVNLEAVVFPSAPSLKIPVTVD 430 + + LP+V ++ G+ +L N A FP P P+ V+ Sbjct: 247 IIARELPDVDVVVGGHSHTFLYNGTADGFPDDPEDTYPIVVE 288 >AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleotidase protein. Length = 568 Score = 28.3 bits (60), Expect = 0.32 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 305 VTVQSLPNVSSIIKGYRDAYLVNLEAVVFPSAPSLKIPVTVD 430 + + LP+V ++ G+ +L N A FP P P+ V+ Sbjct: 247 IIARELPDVDVVVGGHSHTFLYNGTADGFPDDPEDTYPIVVE 288 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 25.8 bits (54), Expect = 1.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -2 Query: 299 SIWFRCQ*DRSTGVEKG*SNVEETVPG 219 ++W CQ + GVE+G V +PG Sbjct: 190 TVWSHCQCVLADGVERGILTVNRMIPG 216 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 25.8 bits (54), Expect = 1.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -2 Query: 299 SIWFRCQ*DRSTGVEKG*SNVEETVPG 219 ++W CQ + GVE+G V +PG Sbjct: 190 TVWSHCQCVLADGVERGILTVNRMIPG 216 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 25.8 bits (54), Expect = 1.7 Identities = 20/64 (31%), Positives = 26/64 (40%) Frame = +1 Query: 529 SSHPPLRSRLHQPDHQIPDSIHQPPQT*HPFPSIP*TPYXKEFAPGLKPPLSSEAPSAYL 708 SSH P+ + H H + QPP HP P + PG +S SA + Sbjct: 807 SSHSPVGAGSHHLHHLHHHAAQQPPPGSHPGAQT--QPQLSQHPPG-----ASGRSSAVI 859 Query: 709 TPSS 720 TP S Sbjct: 860 TPPS 863 Score = 25.0 bits (52), Expect = 2.9 Identities = 17/58 (29%), Positives = 23/58 (39%), Gaps = 2/58 (3%) Frame = +1 Query: 511 RSRPYASSHPPLRSRLHQPDHQIPDSIHQPPQT*HPFPSI--P*TPYXKEFAPGLKPP 678 + RP S PP+ S Q Q +H P + H + P +PGL PP Sbjct: 68 QKRPVTSPAPPVLSSSAQQQQQQQQLLHHPSSSPHSNHLLGGPNHHLPPGASPGLVPP 125 >AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant receptor Or2 protein. Length = 378 Score = 24.2 bits (50), Expect = 5.1 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +2 Query: 371 NLEAVVFPSAPSLKIPVTVDLCWTTADVTVEGVNVLATPS 490 NL F SA + P+ V VT+ GV+VLATP+ Sbjct: 123 NLWLGAFISACFVTYPLFVPGRGLPYGVTIPGVDVLATPT 162 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 812,614 Number of Sequences: 2352 Number of extensions: 17333 Number of successful extensions: 36 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 91372671 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -