BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_P07 (853 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 25 3.9 DQ370044-1|ABD18605.1| 99|Anopheles gambiae putative salivary ... 24 5.1 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 6.7 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 8.9 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 23 8.9 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 23 8.9 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 24.6 bits (51), Expect = 3.9 Identities = 28/99 (28%), Positives = 48/99 (48%), Gaps = 2/99 (2%) Frame = +3 Query: 33 VVTQISATMSGGLDVLALNEEDVTKMLAATTHLGAENVNFQMETYVYKRRADGTH--VIN 206 +VT+++ + G+D+LA +EDV + L E T +++RR DGT + Sbjct: 202 IVTEMAEVLITGIDMLA-KKEDVERGL----QRALERTAVAATTSLWERR-DGTQRARVR 255 Query: 207 LRRAWEKLVLAARAVVAIENPADVFVISSRPFGQRAVLK 323 L R L+L R VV V ++ S P Q++ ++ Sbjct: 256 LPRRDTDLLLDKRIVVG----HSVCLVRSAPKQQQSAVR 290 >DQ370044-1|ABD18605.1| 99|Anopheles gambiae putative salivary secreted peptide withTIL domain protein. Length = 99 Score = 24.2 bits (50), Expect = 5.1 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +2 Query: 203 QLASCLGKTCSGCSCCRSH--REPR*CVR 283 Q+ SC G SGC C + RE CV+ Sbjct: 48 QMLSCTGVCVSGCFCRPGYFRREDNACVK 76 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.8 bits (49), Expect = 6.7 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = -2 Query: 327 QTSVQHADRRAVMR*RTHQRGSRW-LRQHEQPEQVFPRHDAS*SHG 193 Q +Q ++ + + HQ+ + L+ H QP+ H +S SHG Sbjct: 1305 QQQLQQQQQQQQQQQQQHQQHQQHQLQHHHQPQLSQSSHHSSSSHG 1350 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.4 bits (48), Expect = 8.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 279 THQRGSRWLRQHEQPEQVFPRHDAS*SHGYHQH 181 +HQ+ S+ QH + P H H +HQH Sbjct: 262 SHQQQSQ---QHPSSQHQQPTHQTHHHHHHHQH 291 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 23.4 bits (48), Expect = 8.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 279 THQRGSRWLRQHEQPEQVFPRHDAS*SHGYHQH 181 +HQ+ S+ QH + P H H +HQH Sbjct: 262 SHQQQSQ---QHPSSQHQQPTHQTHHHHHHHQH 291 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 23.4 bits (48), Expect = 8.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = -2 Query: 279 THQRGSRWLRQHEQPEQVFPRHDAS*SHGYHQH 181 +HQ+ S+ QH + P H H +HQH Sbjct: 214 SHQQQSQ---QHPSSQHQQPTHQTHHHHHHHQH 243 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 947,686 Number of Sequences: 2352 Number of extensions: 21757 Number of successful extensions: 42 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90545769 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -