BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_O18 (1034 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O35328 Cluster: Proline-rich protein 9-1; n=2; Mus musc... 28 3.8 UniRef50_UPI0000F2EA07 Cluster: PREDICTED: hypothetical protein;... 33 9.1 >UniRef50_O35328 Cluster: Proline-rich protein 9-1; n=2; Mus musculus|Rep: Proline-rich protein 9-1 - Mus musculus (Mouse) Length = 181 Score = 27.9 bits (59), Expect(2) = 3.8 Identities = 13/47 (27%), Positives = 16/47 (34%) Frame = -2 Query: 982 GXGXXXXXXAGXWWXNXXXXPPTRXRXXXXKXXGSKXXTPXTPPPPP 842 G G G W + P R R + + P PPPPP Sbjct: 100 GGGGGKRWQLGGLWRSRLRSCPARARVLPLRPPPHRPRRPPPPPPPP 146 Score = 25.8 bits (54), Expect(2) = 3.8 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -2 Query: 868 TPXTPPPPPP 839 TP +PPPPPP Sbjct: 159 TPPSPPPPPP 168 >UniRef50_UPI0000F2EA07 Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 92 Score = 33.5 bits (73), Expect = 9.1 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = -3 Query: 144 PKAXKNRHXTFXRWRGTKKFSKNSPKLRAPNPGGLSXGNFPXEPPGK 4 P A R ++ G K+ + +P R P PG G+ P EPPG+ Sbjct: 6 PAAGALRGLSWAGRPGVKRSPRAAPPERGPEPGAQPTGHGPPEPPGR 52 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 614,124,590 Number of Sequences: 1657284 Number of extensions: 9137610 Number of successful extensions: 52373 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20922 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43821 length of database: 575,637,011 effective HSP length: 101 effective length of database: 408,251,327 effective search space used: 99205072461 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -