BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_O17 (889 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50260.1 68414.m05635 C2 domain-containing protein low simila... 30 1.8 At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family prot... 30 2.4 At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, put... 30 2.4 At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 29 5.4 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 29 5.4 At2g45560.1 68415.m05665 cytochrome P450 family protein 29 5.4 At2g35530.1 68415.m04352 bZIP transcription factor family protei... 29 5.4 At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative... 28 7.2 At5g22740.1 68418.m02656 glycosyl transferase family 2 protein s... 28 9.5 >At1g50260.1 68414.m05635 C2 domain-containing protein low similarity to CLB1 [Lycopersicon esculentum] GI:2789434; contains Pfam profile PF00168: C2 domain Length = 675 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +1 Query: 193 RTRVLRPSADLPSRKVVSVSFRARSTRFCTTAVQRSAQN 309 R+RVLRPS + + + +S FR S T R A N Sbjct: 37 RSRVLRPSVKISNFRFISCGFRGNSKNLRLTDSSRKAAN 75 >At5g64380.1 68418.m08087 fructose-1,6-bisphosphatase family protein similar to SP|P22418 Fructose-1,6-bisphosphatase, chloroplast precursor (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase) (FBPase) {Spinacia oleracea}; contains Pfam profile PF00316: fructose-1,6-bisphosphatase Length = 404 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = -1 Query: 658 ATXLMSPYNARLESSSTGSSFPADSPKPVPLAVVSLD 548 A+ + SP+N+ L S SS +D P PL +VS D Sbjct: 105 ASLVASPFNSSLGKLSVNSSSGSDRDAPKPLDIVSND 141 >At2g28990.1 68415.m03526 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 884 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +2 Query: 176 TFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPFNGQLRT 310 T+ T SG R++L+ R+ D HD + PFNG T Sbjct: 179 TYVTQSGSLMMSF-RVYLSNSDASIRYADDVHDRIWSPFNGSSHT 222 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 28.7 bits (61), Expect = 5.4 Identities = 9/37 (24%), Positives = 22/37 (59%) Frame = -1 Query: 460 IVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGHRNA 350 ++T V P ++ F+H I + ++ + V+ + GH+ + Sbjct: 33 VMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTS 69 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 28.7 bits (61), Expect = 5.4 Identities = 9/37 (24%), Positives = 22/37 (59%) Frame = -1 Query: 460 IVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGHRNA 350 ++T V P ++ F+H I + ++ + V+ + GH+ + Sbjct: 32 VMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTS 68 >At2g45560.1 68415.m05665 cytochrome P450 family protein Length = 512 Score = 28.7 bits (61), Expect = 5.4 Identities = 19/53 (35%), Positives = 25/53 (47%) Frame = +3 Query: 39 GREADAAGAGSGRCSCVMFVLAS*YFNIMRPQKLYIFNMTLAKIVLRFGLDPD 197 GR+ + G+GR C LA ++M LY F+ L K VL LD D Sbjct: 435 GRDYELTPFGAGRRICPGMPLAMKTVSLMLASLLYSFDWKLPKGVLSEDLDMD 487 >At2g35530.1 68415.m04352 bZIP transcription factor family protein contains Pfam domain PF00170: bZIP transcription factor; similar to G-Box binding protein 2 (GI:5381313) [Catharanthus roseus]. Length = 409 Score = 28.7 bits (61), Expect = 5.4 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 1 YWIGSEDRGVSGLDGKRMRPVPGLV 75 YW G+ G+ GK PVPG+V Sbjct: 262 YWGAPTSAGIPGMHGKVSTPVPGVV 286 >At5g16980.1 68418.m01989 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 239 Score = 28.3 bits (60), Expect = 7.2 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 200 RVRIQSET*DDFRECHIKYIQFLRPH 123 R+RIQ DF + + K+++FL PH Sbjct: 172 RIRIQGFVVSDFYDEYSKFLEFLHPH 197 >At5g22740.1 68418.m02656 glycosyl transferase family 2 protein similar to beta-(1-3)-glucosyl transferase GB:AAC62210 GI:3687658 from [Bradyrhizobium japonicum], cellulose synthase from Agrobacterium tumeficiens [gi:710492] and Agrobacterium radiobacter [gi:710493]; contains Pfam glycosyl transferase, group 2 family protein domain PF00535 Length = 534 Score = 27.9 bits (59), Expect = 9.5 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = +2 Query: 128 ASKTVYI*YDTRENRLTFRTGSGPAFSGLPRIFLAVRSCRFRFVRDRHDSVRPPF 292 ASK + I Y RENR+ ++ G+ GL R + V+ C + + D P F Sbjct: 154 ASKGINIRYQIRENRVGYKAGA--LKEGLKRSY--VKHCEYVVIFDADFQPEPDF 204 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,585,792 Number of Sequences: 28952 Number of extensions: 379759 Number of successful extensions: 939 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 939 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2081245872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -